DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: stwl and CG45071

Sequence 1:NP_001261839.1 Gene:stwl FlyBaseID:FBgn0003459 Length:1037 Species:Drosophila melanogaster
Sequence 2:NP_730024.1 Gene:CG45071 FlyBaseID:FBgn0266441 Length:429 Species:Drosophila melanogaster

Alignment Length:639 Identity:104/640 (16%)
Similarity:193/640 (30%) Gaps:261/640 (41%)


  Fly    12 LRSVEKQTALYDRTDENYRKRLPSENAWDMV--ASEVGESVEKCKRRWRQLRN----DYTRWCNA 70
            :..:|::.|:::|.....:..|  |..||.:  |.::.:.|.|.|  |:.||:    :|.|...|
  Fly    16 IHDIEERPAIWNRNFHCNKAFL--EQMWDELSGAHKLPKIVLKAK--WKGLRDNFRVEYKRIPRA 76

  Fly    71 DANRRRNGQRRLAYPLADELRFLDRHLNIADDMAADDDRSVSSDKDRDNNRDSEGVDHHAQASLK 135
            |     ||..     :.|...|                             :|:.:.::|...|.
  Fly    77 D-----NGDF-----MVDPATF-----------------------------ESKWLHYYALLFLT 102

  Fly   136 ERASSTSKLVKEVKLASQVRKEKSSQDKRENWENPGDKQRSRKKSAEEKLNDLEESDEPEKV--- 197
            :..                                  :.|..|...::.....::|::.||.   
  Fly   103 DHM----------------------------------RHRLPKNEQDQSFYFSQQSEDCEKTVVE 133

  Fly   198 PEL-DSFLQSDNEDDECMDEEHLEDLEGFDFDLEQSNQEKEL-TPEKSLEKNNTDSTVSQPEFFV 260
            |:| :..::...:.||..|||.:|    .|.:..::..|:.: ||..:.:.|...:|        
  Fly   134 PDLTNGLIRRLQDSDEDYDEEEME----ADGEASEATMEETMPTPPAAHQMNQVSTT-------- 186

  Fly   261 KQTRDPRLLIIGRKNSTSSFAESKASKSISGDPLETAMEDSGDEYGRDGEKRVTGSDTTSPTRRP 325
                                            ||                       .|...|..
  Fly   187 --------------------------------PL-----------------------ATGALRAQ 196

  Fly   326 RRAARASISFAGIRDLPIQKPGQAQRMTRLQRRKSMSLAAVHSVRSSTSPVKMT-PV-PRSQPIN 388
            ..|.:.::..||:.        :||.|...:..:.:|       |....|.:|| || |..|.:.
  Fly   197 EEAHQHALIKAGLL--------RAQLMELEKEAEDLS-------RKPPPPQQMTSPVAPSLQVLV 246

  Fly   389 KPPSGPVQITKISHRDDIFPRPAVPSGVVNINQNQLKTQQQQKTLIFPTTDEAIANPQGSGPPQ- 452
            :||:....           |.|.|.:....:.      |.....::.|.|..:.::...:|.|. 
  Fly   247 EPPAAHCS-----------PPPMVTTTSAQVQ------QPGSAAVLAPATTTSASSVSSNGAPMG 294

  Fly   453 -RRSVGRPP---KKLPMVQRIVAPETQTKPQSPINTKVLTIGKPTSSVASGNINNIAIKSNVVTS 513
             :|||..||   |....:..:.|.....|.::.      ..| |||:| .||.::::...:    
  Fly   295 GKRSVSPPPLYNKAHHPLATLAAAHLAAKDRNE------DFG-PTSAV-GGNGDHLSFTQH---- 347

  Fly   514 ISSSTATTNTITKGTSNNSIKTTENVNVISYSPNSSSTSSSSKATTGASGAVITNIPTTTTAGTS 578
                 :..|.:.........:.:|:.|.     |.|||..:...                     
  Fly   348 -----SYANGLIPALKLKRPRLSEDSNF-----NGSSTMDTPLV--------------------- 381

  Fly   579 VPVGKSITQLKMTERGTQTGVQNPFSDNY-FLEMIKPQMQEMNPRQKMHFKKKV 631
                                   |..|:| :|..:.|.|:::...||:..:.|:
  Fly   382 -----------------------PEDDDYHYLLSLHPYMKQLTAAQKLRIRTKI 412

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stwlNP_001261839.1 MADF 11..98 CDD:214738 22/92 (24%)
BESS 604..637 CDD:281011 8/30 (27%)
CG45071NP_730024.1 MADF 14..106 CDD:214738 25/167 (15%)
BESS 384..418 CDD:281011 8/30 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.