| Sequence 1: | NP_001261839.1 | Gene: | stwl / 39581 | FlyBaseID: | FBgn0003459 | Length: | 1037 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_021332041.1 | Gene: | LOC110439798 / 110439798 | -ID: | - | Length: | 273 | Species: | Danio rerio |
| Alignment Length: | 262 | Identity: | 71/262 - (27%) |
|---|---|---|---|
| Similarity: | 101/262 - (38%) | Gaps: | 57/262 - (21%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 3 AASEVNLMLLRSVEKQTALYDRTDENYRKRLPSENAWDMVASEVGESVEKCKRRWRQLRNDYTRW 67
Fly 68 CNADANRRRNGQRRLAY-PLADELRFLDRHLNIADDMAADDDRSVSSDKDRDNNRDS-------E 124
Fly 125 GVDHHAQASLKER---------ASSTSKLVK-----EVKLASQVRKEKSSQDKRENWENPGDKQR 175
Fly 176 SRKKSAEEKLNDLEESDEPEKVPELDSFLQSDNEDDECMDEEHLEDLEGFDFDLEQSNQEKELTP 240
Fly 241 EK 242 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| stwl | NP_001261839.1 | MADF | 11..98 | CDD:214738 | 34/87 (39%) |
| BESS | 604..637 | CDD:281011 | |||
| LOC110439798 | XP_021332041.1 | MADF | 32..120 | CDD:214738 | 34/106 (32%) |
| BESS | 233..267 | CDD:308542 | 10/28 (36%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1634040at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.920 | |||||