DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: stwl and si:zfos-128g4.1

Sequence 1:NP_001261839.1 Gene:stwl FlyBaseID:FBgn0003459 Length:1037 Species:Drosophila melanogaster
Sequence 2:XP_002661969.1 Gene:si:zfos-128g4.1 ZFINID:ZDB-GENE-141212-382 Length:248 Species:Danio rerio

Alignment Length:264 Identity:72/265 (27%)
Similarity:98/265 (37%) Gaps:63/265 (24%)


  Fly     3 AASEVNLMLLRSVEKQTALYDRTDENYRKRLPSENAWDMVASEVGESVEKCKRRWRQLRNDYTRW 67
            ||||   .|:::|.....||:.:..:||.......||..||:.||.||.:|||||:.:|:.|.|.
Zfish     4 AASE---KLIQTVYAFPVLYNVSLHDYRSTERRVKAWREVAASVGLSVVECKRRWKTIRDRYIRE 65

  Fly    68 CNADANRRRNGQRRLAY-PLADELRFLDRHLNIADDMAADDDRSVSSDKDRDNNRDS-------E 124
            ......::..|.|||.| |..:.|.|||.|:                   |...|.|       |
Zfish    66 RRLCKLKKDLGGRRLHYWPHRESLAFLDAHI-------------------RKRRRPSGAQGPEEE 111

  Fly   125 GVDHHAQASLKER--------ASSTSKLVKEVKLASQVRKEKSSQDKRENWEN--------PGDK 173
            ..:.|:.|:|:|.        ..|.|:|.......|.:......|.|.....:        ||.|
Zfish   112 QQEEHSSAALQEDKECVSEECVDSGSRLAVSPLPVSIMSAPPPPQLKAVPQVSPLLLAALPPGLK 176

  Fly   174 QRSRKKSAEEKLNDLEESDEPEKVPELDSFLQSDNEDDECMDEEHLEDLEGFDFDLEQSNQEKEL 238
            ......||..     ..|..|..||     |:.....|..:||:.|       |.|......|.|
Zfish   177 VAPVCSSATG-----SASAGPLNVP-----LEEQQRADGALDEDQL-------FLLSYVPALKRL 224

  Fly   239 TPEK 242
            ||:|
Zfish   225 TPQK 228

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stwlNP_001261839.1 MADF 11..98 CDD:214738 33/88 (38%)
BESS 604..637 CDD:281011
si:zfos-128g4.1XP_002661969.1 MADF 8..97 CDD:214738 33/108 (31%)
BESS 208..242 CDD:281011 10/29 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1634040at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.