DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: stwl and LOC100330838

Sequence 1:NP_001261839.1 Gene:stwl FlyBaseID:FBgn0003459 Length:1037 Species:Drosophila melanogaster
Sequence 2:XP_002665853.1 Gene:LOC100330838 ID: Length:204 Species:Danio rerio

Alignment Length:181 Identity:40/182 (22%)
Similarity:81/182 (45%) Gaps:22/182 (12%)


  Fly    11 LLRSVEKQTALYDRTDENYRKRLPSENAWDMVASEVGESVEKCKRRWRQLRNDYTRWCNADANRR 75
            |:.:|.....||:.|..:|:.......||..|:.:|....|.|:|||:.||:.:.:...|:..||
Zfish     9 LIAAVSDYPELYNSTINSYKDAARKAKAWRAVSLQVEIPEEDCRRRWKSLRDMFIKDKRAEQRRR 73

  Fly    76 RNGQRRLAYPLADELRFLDRHLNIADDMAADDDRSVSSDKDRDNNRDSEGVDHHAQASLKERASS 140
            .:|....::..:.::.||...:. :..:|||:......|:|:|..|.::|              :
Zfish    74 ASGTSHRSWKYSWQMSFLTPFIQ-SRSLAADEPEEDRDDEDKDEERTADG--------------N 123

  Fly   141 TSKLVKEVKLASQVRKEKSSQDKRENWENPGDKQRSRKKSAEEKLN-DLEE 190
            ::.:|::.:      .:....|...::...|.:...||:....:.| |||:
Zfish   124 SAFVVQDFE------GDHGMLDGASHYSASGSQGSGRKRKWHMEANEDLED 168

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stwlNP_001261839.1 MADF 11..98 CDD:214738 23/87 (26%)
BESS 604..637 CDD:281011
LOC100330838XP_002665853.1 MADF 8..96 CDD:214738 23/87 (26%)
BESS 167..200 CDD:281011 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1634040at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.