DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and HMGB5

DIOPT Version :10

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_195282.1 Gene:HMGB5 / 829709 AraportID:AT4G35570 Length:125 Species:Arabidopsis thaliana


Alignment Length:68 Identity:16/68 - (23%)
Similarity:37/68 - (54%) Gaps:4/68 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 KRPMNAFMVWSRGQRRKMAQDNPKMHN-SEISKRLGAEWKLLTEGQKRPFIDEAKRLR---ALHM 182
            |:|.:.|.|:....|::....||...: ..:.:..|.:||.:||.::.||:.:::..:   |:.|
plant    35 KKPPSPFFVFLDDFRKEFNLANPDNKSVGNVGRAAGKKWKTMTEEERAPFVAKSQSKKTEYAVTM 99

  Fly   183 KEH 185
            :::
plant   100 QQY 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 HMG-box_SoxB 119..198 CDD:438790 16/68 (24%)
HMGB5NP_195282.1 HMG-box_AtHMGB1-like 35..95 CDD:438821 14/59 (24%)

Return to query results.
Submit another query.