DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and 3xHMG-box1

DIOPT Version :10

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_192846.1 Gene:3xHMG-box1 / 826709 AraportID:AT4G11080 Length:446 Species:Arabidopsis thaliana


Alignment Length:91 Identity:23/91 - (25%)
Similarity:46/91 - (50%) Gaps:2/91 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 HHNAPTSHSNSNTGSHHNSHDHIKRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKLLT 163
            |......|.|.............|:|::|:::::..:|..:..:|..:  .|::|..|.|||.|:
plant   224 HFVQEAEHDNKKKAKKIKDPLKPKQPISAYLIYANERRAALKGENKSV--IEVAKMAGEEWKNLS 286

  Fly   164 EGQKRPFIDEAKRLRALHMKEHPDYK 189
            |.:|.|:...||:.:.::::|...||
plant   287 EEKKAPYDQMAKKNKEIYLQEMEGYK 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 HMG-box_SoxB 119..198 CDD:438790 20/71 (28%)
3xHMG-box1NP_192846.1 PTZ00121 <11..361 CDD:173412 23/91 (25%)
HMG-box_AtHMGB6-like_rpt1 130..197 CDD:438822
HMG-box_AtHMGB6-like_rpt2 246..311 CDD:438823 18/66 (27%)
HMG-box_AtHMGB6-like_rpt3 363..440 CDD:438824
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.