DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and SOX6

DIOPT Version :10

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001139291.2 Gene:SOX6 / 55553 HGNCID:16421 Length:828 Species:Homo sapiens


Alignment Length:80 Identity:42/80 - (52%)
Similarity:61/80 - (76%) Gaps:0/80 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 NSHDHIKRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKLLTEGQKRPFIDEAKRLRAL 180
            :|..||||||||||||::.:|||:.|..|.||||.|||.||:.||.::..:|:|:.:|..||..:
Human   616 SSEPHIKRPMNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKSMSNQEKQPYYEEQARLSKI 680

  Fly   181 HMKEHPDYKYRPRRK 195
            |::::|:|||:||.|
Human   681 HLEKYPNYKYKPRPK 695

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 HMG-box_SoxB 119..198 CDD:438790 41/77 (53%)
SOX6NP_001139291.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..51
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 380..470
HMG-box_EGL13-like 619..696 CDD:438848 41/77 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 753..828
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.