DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and hmgb3

DIOPT Version :10

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001004888.1 Gene:hmgb3 / 448228 XenbaseID:XB-GENE-1002014 Length:202 Species:Xenopus tropicalis


Alignment Length:85 Identity:25/85 - (29%)
Similarity:46/85 - (54%) Gaps:5/85 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 KRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKLLTEGQKRPFIDEAKRLRALHMKEHP 186
            |||.:.|.::....|.|:...||.:...:::|:||..|..|.:|:|:|:.::|.:|:..:.|:..
 Frog    94 KRPPSGFFLFCSEFRPKIKSTNPGISIGDVAKKLGEMWNNLNDGEKQPYNNKAAKLKEKYEKDVA 158

  Fly   187 DYKYR-----PRRKPKTLNK 201
            |||.:     .:..||...|
 Frog   159 DYKSKGKFDCAKGAPKLARK 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 HMG-box_SoxB 119..198 CDD:438790 23/80 (29%)
hmgb3NP_001004888.1 HMG-box_HMGB_rpt1 13..76 CDD:438794
HMG-box_HMGB_rpt2 91..161 CDD:438795 20/66 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.