DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and HMGB2

DIOPT Version :10

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_002120.1 Gene:HMGB2 / 3148 HGNCID:5000 Length:209 Species:Homo sapiens


Alignment Length:125 Identity:28/125 - (22%)
Similarity:50/125 - (40%) Gaps:33/125 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 KRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKLLTEGQKRPFIDEAKRLRALHMKEHP 186
            |||.:||.::....|.|:..::|.:...:.:|:||..|...:...|:|:..:|.:|:..:.|:..
Human    96 KRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIA 160

  Fly   187 DYKYRPRRKPKTLNKSPVPGGGGGGGGGGANGGVNAGGAGNSGPSGPG-SVGSPKDMQPQ 245
            .|:                                |.|...:|..||| ..||.|..:|:
Human   161 AYR--------------------------------AKGKSEAGKKGPGRPTGSKKKNEPE 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 HMG-box_SoxB 119..198 CDD:438790 18/75 (24%)
HMGB2NP_002120.1 HMG-box_HMGB_rpt1 8..76 CDD:438794
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 52..150 15/53 (28%)
HMG-box_HMGB_rpt2 93..163 CDD:438795 17/66 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 162..209 11/59 (19%)
Required for chemotactic activity. /evidence=ECO:0000269|PubMed:19811285 165..180 5/14 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.