DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and HMGB1

DIOPT Version :10

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_002119.1 Gene:HMGB1 / 3146 HGNCID:4983 Length:215 Species:Homo sapiens


Alignment Length:83 Identity:23/83 - (27%)
Similarity:42/83 - (50%) Gaps:2/83 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 KRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKLLTEGQKRPFIDEAKRLRALHMKEHP 186
            |||.:||.::....|.|:..::|.:...:::|:||..|.......|:|:..:|.:|:..:.|:..
Human    96 KRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIA 160

  Fly   187 DYKYRPRRKPKTLNKSPV 204
              .||.:.||....|..|
Human   161 --AYRAKGKPDAAKKGVV 176

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 HMG-box_SoxB 119..198 CDD:438790 21/75 (28%)