DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and sox11b

DIOPT Version :10

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_571412.1 Gene:sox11b / 30603 ZFINID:ZDB-GENE-980526-466 Length:368 Species:Danio rerio


Alignment Length:86 Identity:54/86 - (62%)
Similarity:69/86 - (80%) Gaps:1/86 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 HIKRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKLLTEGQKRPFIDEAKRLRALHMKE 184
            |||||||||||||:.:|||:.:.:|.|||:|||||||..||:|.:.:|.|||.||:|||..||.:
Zfish    45 HIKRPMNAFMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLQHMAD 109

  Fly   185 HPDYKYRPRRKPKTLNKSPVP 205
            :|||||||::||| |:.|..|
Zfish   110 YPDYKYRPKKKPK-LDSSSKP 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 HMG-box_SoxB 119..198 CDD:438790 50/77 (65%)
sox11bNP_571412.1 HMG-box_SoxC_SOX11 35..126 CDD:438846 52/81 (64%)

Return to query results.
Submit another query.