DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and mat1-Mc

DIOPT Version :10

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_595867.1 Gene:mat1-Mc / 2539619 PomBaseID:SPBC23G7.09 Length:181 Species:Schizosaccharomyces pombe


Alignment Length:78 Identity:23/78 - (29%)
Similarity:47/78 - (60%) Gaps:0/78 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 SHDHIKRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKLLTEGQKRPFIDEAKRLRALH 181
            |.:...||.|||:::.:.:...:.:.||.::||::||.:|..|:..::..:..:...::..:|.|
pombe    99 STERTPRPPNAFILYRKEKHATLLKSNPSINNSQVSKLVGEMWRNESKEVRMRYFKMSEFYKAQH 163

  Fly   182 MKEHPDYKYRPRR 194
            .|.:|.|||:||:
pombe   164 QKMYPGYKYQPRK 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 HMG-box_SoxB 119..198 CDD:438790 22/76 (29%)
mat1-McNP_595867.1 HMG-box_ROX1-like 104..174 CDD:438791 20/69 (29%)

Return to query results.
Submit another query.