DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and Sox18

DIOPT Version :10

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_033262.2 Gene:Sox18 / 20672 MGIID:103559 Length:377 Species:Mus musculus


Alignment Length:350 Identity:97/350 - (27%)
Similarity:145/350 - (41%) Gaps:94/350 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 GVGS-----GSGNTTPPPMPPADLAVPPAAPTPVAPKMHQHTHHHGNSHHNAPTSHSNSNTGSHH 115
            |:|:     |...|...|..||..:..|.:| |.:|:..::                ....|...
Mouse    25 GIGAAAEARGLPVTNVSPTSPASPSSLPRSP-PRSPESGRY----------------GFGRGERQ 72

  Fly   116 NSHD-HIKRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKLLTEGQKRPFIDEAKRLRA 179
            .:.: .|:|||||||||::.:|:::||.||.:||:.:||.||..||.|...:||||::||:|||.
Mouse    73 TADELRIRRPMNAFMVWAKDERKRLAQQNPDLHNAVLSKMLGKAWKELNTAEKRPFVEEAERLRV 137

  Fly   180 LHMKEHPDYKYRPRRK---------------PKTLNKSPVPGGGGGGGGGGAN-GGVNAGGAGNS 228
            .|:::||:||||||||               |..:..|..|.......|...: ..:...||...
Mouse   138 QHLRDHPNYKYRPRRKKQARKVRRLEPGLLLPGLVQPSAPPEAFAAASGSARSFRELPTLGAEFD 202

  Fly   229 GPSGPGSVGSPKDMQPQLSPLGQSLPHLHGHPHQSPYQSHPHHPHP-------HPHHVQLAAATL 286
            |      :|.|   .|:.|||...      .|.::.:...|..|..       .|:..:||.   
Mouse   203 G------LGLP---TPERSPLDGL------EPGEASFFPPPLAPEDCALRAFRAPYAPELAR--- 249

  Fly   287 SAKYGFGSPLELSLPRLPNAFPGLAHYPLDPTLALDLQARLQAMYAGSIYHPWRYLPLISPETPP 351
            ...:.:|:||..:|...|.|.|                  |..:|.|::..|..:...:||  ||
Mouse   250 DPSFCYGAPLAEALRTAPPAAP------------------LAGLYYGTLGTPGPFPNPLSP--PP 294

  Fly   352 SPPSSSGTGISSYGCVKSEKSSPNA 376
            ..||..||          |:..|.|
Mouse   295 ESPSLEGT----------EQLEPTA 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 HMG-box_SoxB 119..198 CDD:438790 45/94 (48%)
Sox18NP_033262.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..76 12/67 (18%)
HMG-box_SoxF_SOX18 76..155 CDD:438851 44/78 (56%)
Interaction with DNA. /evidence=ECO:0000269|PubMed:26939885 81..94 9/12 (75%)
Interaction with DNA. /evidence=ECO:0000269|PubMed:26939885 105..117 6/11 (55%)
Important for transcriptional activation. /evidence=ECO:0000269|PubMed:10742113, ECO:0000269|PubMed:7651823 160..225 14/79 (18%)
Sox17_18_mid 191..239 CDD:463454 12/62 (19%)
9aaTAD. /evidence=ECO:0000250|UniProtKB:P35713 318..326
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.