DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and sox-2

DIOPT Version :10

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_741836.1 Gene:sox-2 / 181002 WormBaseID:WBGene00004949 Length:283 Species:Caenorhabditis elegans


Alignment Length:135 Identity:80/135 - (59%)
Similarity:98/135 - (72%) Gaps:10/135 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 VPPAAPTPVAPKMHQHTHHHGNSHHNAPTSHSNSNTGSHHNSHDHIKRPMNAFMVWSRGQRRKMA 140
            :||.:.|.:.|:...      :...|.|.|..::......|. |.:|||||||||||||||:|||
 Worm    22 MPPTSSTNLLPQSMP------DDLSNGPDSPDSTGKDGKKND-DRVKRPMNAFMVWSRGQRKKMA 79

  Fly   141 QDNPKMHNSEISKRLGAEWKLLTEGQKRPFIDEAKRLRALHMKEHPDYKYRPRRKPKTLNK---S 202
            .:||||||||||||||.|||:|:|.:|||||||||||||:|||||||||||||||.|::||   :
 Worm    80 LENPKMHNSEISKRLGTEWKMLSEQEKRPFIDEAKRLRAIHMKEHPDYKYRPRRKTKSINKKNGA 144

  Fly   203 PVPGG 207
            |:|.|
 Worm   145 PIPFG 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 HMG-box_SoxB 119..198 CDD:438790 66/78 (85%)
sox-2NP_741836.1 HMG-box_SoxB 58..137 CDD:438790 66/78 (85%)

Return to query results.
Submit another query.