DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and hmg-1.2

DIOPT Version :10

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001380090.1 Gene:hmg-1.2 / 175890 WormBaseID:WBGene00001972 Length:235 Species:Caenorhabditis elegans


Alignment Length:68 Identity:17/68 - (25%)
Similarity:37/68 - (54%) Gaps:0/68 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 KRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKLLTEGQKRPFIDEAKRLRALHMKEHP 186
            ||.::||..:|:.:|.::...:|.....::::.||..|||:.:..|..:..:|:..:..:..|..
 Worm   136 KRALSAFFFYSQDKRPEIQAGHPDWKVGQVAQELGKMWKLVPQETKDMYEQKAQADKDRYADEMR 200

  Fly   187 DYK 189
            :||
 Worm   201 NYK 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 HMG-box_SoxB 119..198 CDD:438790 17/68 (25%)
hmg-1.2NP_001380090.1 HMG-box_HMGB_rpt1 44..112 CDD:438794
HMG-box_SF 124..202 CDD:469606 15/65 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.