DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and HMGB4

DIOPT Version :10

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_660206.2 Gene:HMGB4 / 127540 HGNCID:24954 Length:186 Species:Homo sapiens


Alignment Length:78 Identity:19/78 - (24%)
Similarity:38/78 - (48%) Gaps:8/78 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 KRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKLLTEGQKRPFIDEAKRLRALHMKEHP 186
            :||.::|:::.:....::.::||.....:::|..|..|...|:.:|.|:......|||.:.:|..
Human    94 RRPPSSFLLFCQDHYAQLKRENPNWSVVQVAKATGKMWSTATDLEKHPYEQRVALLRAKYFEELE 158

  Fly   187 DY--------KYR 191
            .|        |||
Human   159 LYRKQCNARKKYR 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 HMG-box_SoxB 119..198 CDD:438790 19/78 (24%)
HMGB4NP_660206.2 HMG-box_HMGB_rpt1 8..76 CDD:438794
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 77..98 2/3 (67%)
HMG-box_HMGB_rpt2 91..161 CDD:438795 15/66 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.