DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8100 and Lsp2

DIOPT Version :8

Sequence 1:NP_001261825.1 Gene:CG8100 / 39565 FlyBaseID:FBgn0036410 Length:648 Species:Drosophila melanogaster
Sequence 2:NP_001287042.1 Gene:Lsp2 / 45326 FlyBaseID:FBgn0002565 Length:701 Species:Drosophila melanogaster

Alignment Length:720 Identity:150/721 (21%)
Similarity:263/721 (36%) Gaps:217/721 (30%)


  Fly    26 KYFGSSNVEVNYNQRQDRQYFLLNLLIQVHKPLLHEELITM---GSQLNDDPDSYKEGTWRYIKD 87
            |:..|...:.::..:|...|.:|..:.|       :::.|.   ||.:...|       |.::.|
  Fly    22 KHLDSKVADKDFLMKQKFMYQILQHIYQ-------DDVFTTPFGGSYVEYKP-------WEHVAD 72

  Fly    88 FRERVHQNRVP--------GPFV------ILNQLDEEMPLNLLGIYRFLTMAVDWTSFQRNACFA 138
            :   ||...:.        .||.      ::....||.   ::|:.|....|.:|.:||....:|
  Fly    73 Y---VHPEMLEHFFELWQHQPFTDDMVWSVMYDKHEEY---VVGLVRLFYFAKNWETFQHVVYWA 131

  Fly   139 RIHFHPLLFVNALQMAVEEREDTKDLRMPAMYEVLPQLYFEKEVILTAQEVTWN------QLSPI 197
            |.|.:..|||.|:.:|...|:|.:.:.:||.||:.|..||:.:.:..|:....:      |:..|
  Fly   132 RQHVNKQLFVYAVTIASLFRDDMQGVVLPAHYEIHPWSYFDSQALEWAEHYKMHGFHHVKQMDNI 196

  Fly   198 RLVTPKRRWIDI--LLGYRNPKQPWMEEEPIPTDPLIIDNARKVAYLSLDLELNSHWNSLITRLI 260
            ..|..:..:.::  .|.|.:....::|:        :..|| ...|.:||...   |.       
  Fly   197 YNVVIRTNYSNVHGSLNYDHDLAYYLED--------VGFNA-FYYYFNLDYPF---WT------- 242

  Fly   261 ISIEEGKEKTNEPIIIDGDRLVAFRGSFDEVNFKKHLALGSHFHNTKLYLYNLHQFVAALSMEDL 325
                    |..|..:::.||    ||                    :||||...|.:|...:|.|
  Fly   243 --------KGGEEHVLNKDR----RG--------------------ELYLYVHWQLLARWYLERL 275

  Fly   326 A--TGQKSTELIYPP--------LMTTGGVP-----------YKGTSLNIEAVRGIIDLTIDGLK 369
            :  .|:.....:|.|        |.|..|||           ::....:||.|.......:|.: 
  Fly   276 SHDLGEVPAFNMYVPTESGYASNLRTYYGVPQWHRENHHSFYHEHNYEHIEHVEMYTQRVMDWI- 339

  Fly   370 DKIEMAVKHNNHAMD--NLSIAGGIIGNN--------YLHICRQLNLAVN-----GQGINQ-PSM 418
                    |.|...|  .:::.|.||..|        |..:.:.....||     |.|... |.:
  Fly   340 --------HKNEKFDVETINVLGNIIQGNADSVDKKFYGSLDKLYRFIVNEGHHYGHGDESFPGL 396

  Fly   419 LGSATSNLRDPI----YRSLLFRIYDLL--------KSYENENIFPDVGGRETPKIVDIQVSRLV 471
            .....:::||||    |::::...:.|:        |.|..|.:..|.        |.:..| |.
  Fly   397 FMHYDTSMRDPIFYEVYKTIVSHYWHLMETYPEYHKKDYAFEGVHIDA--------VHMPES-LT 452

  Fly   472 TFEETMTTDLINLIDQQLLL-------------SHRNNLQFLRRNLVARQHRLNHDPFSIGLDIV 523
            |:.|...:|:.|.::.:..:             ||.....::   :.|||.||||.||...||:.
  Fly   453 TYFEHFDSDISNAVNVEPAVEGSADPLYTFGRNSHYKGSSYV---IKARQQRLNHKPFEFTLDVT 514

  Fly   524 APENLVVEARMYLS-----------LPNQLRLRLHLDSFKCSLKRGLNHFER---QFPTAIS-KP 573
            :.:......::::.           |.:..:....|:.||..|:.|:||.:|   .|...:: :.
  Fly   515 SDKAQDAVVKVFIGPKYDEHGHEIPLEHNYQNFFELEHFKVHLEAGVNHIKRASGDFSFWVNDRT 579

  Fly   574 TLSELYEADYASTDVTTSN-RF-----------PPHLQLPRGTGDGLKLQLLV--------ELSE 618
            |..|||:   ...|.|.|: :|           |..:.||||...|...|...        |:::
  Fly   580 TYLELYQ---KLMDATNSDYKFKLDQSEAHCGVPNRMMLPRGKKGGQVFQFFYMVYPYHQPEVAQ 641

  Fly   619 WNGLE 623
            :.|.:
  Fly   642 FTGYD 646

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8100NP_001261825.1 Hemocyanin_N 41..163 CDD:281684 32/139 (23%)
Hemocyanin_C 444..>621 CDD:281685 49/225 (22%)
Lsp2NP_001287042.1 Hemocyanin_N 33..156 CDD:281684 32/143 (22%)
Hemocyanin_M 163..420 CDD:278784 62/317 (20%)
Hemocyanin_C 430..693 CDD:281685 51/233 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C310625500
eggNOG 1 0.900 E1_28IXN
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11511
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.