DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8100 and CG7320

DIOPT Version :8

Sequence 1:NP_001261825.1 Gene:CG8100 / 39565 FlyBaseID:FBgn0036410 Length:648 Species:Drosophila melanogaster
Sequence 2:NP_649034.3 Gene:CG7320 / 40010 FlyBaseID:FBgn0036782 Length:646 Species:Drosophila melanogaster

Alignment Length:707 Identity:175/708 (25%)
Similarity:275/708 (39%) Gaps:195/708 (28%)


  Fly    42 DRQYFLLNLLIQVHKPLLHEELITMGSQLNDDPDS---YKEGTWRYIKDFR--ERVHQNRVPGPF 101
            ::|.|||.:|..|::||::|:...:|.||..|.:.   |.|...|:.:||.  :.:|:|      
  Fly    30 EKQRFLLEILHHVNEPLMNEQWRLLGKQLVTDKEQYVVYNEQMTRFYEDFSLGKLLHRN------ 88

  Fly   102 VILNQLDEEMPLNLLGIYRFLTMAVDWTSFQRNACFARIHFHPLLFVNALQMAVEEREDTKDLRM 166
            |..|.|..:....:||:|:|...|.||.:..:|..:||:|.||.:||.||...:.:|||.:.|.|
  Fly    89 VRYNPLYADHYRQMLGLYQFFYNARDWYTLWQNISWARVHVHPCIFVQALTQLILKREDYQALIM 153

  Fly   167 PAMYEVLPQLYFEKEVILTA-----------------QEVTWNQLSPIRLVTPKRRWIDILLGYR 214
            |.:||:.|:.|.:...:..|                 :|:...:|.|:.|....|..|:......
  Fly   154 PKIYELWPESYHDDVTVRKARNFNFANWIRYVNMTDVEEIHPQKLEPLNLEGNLRGTIEWFQAMA 218

  Fly   215 NPKQPWMEEEPIPTDPLIIDNARKVAYLSLDLELNSHWNSLITRLIISIEEGKEKTNEPIIIDGD 279
            :.....|.|:         ....|:.:|..|::..|:|.:|...:|::.|            :.|
  Fly   219 DVNILRMNEQ---------KKRNKLEHLLEDIDWQSYWYNLNMGVILTAE------------NSD 262

  Fly   280 RLVAFRGSFDEVNFKKHLALGSHFHNTKLYLYNLHQFVAALSMEDLATGQKSTELIYPPLMTTGG 344
            :|                        .:...|.|.|.:|...:|  ..|||              
  Fly   263 QL------------------------REWCYYQLSQILARYKLE--CYGQK-------------- 287

  Fly   345 VPYKGTSLNIEAVRGI------IDLTIDGLKDKIEMAVKHNNHAMDNLSIAGGIIGNNYLHICRQ 403
            :.||..:.|    |||      |...|..|:.|:...:...:..:.|.|.......||:|....:
  Fly   288 MAYKRLTQN----RGINEEFQFITKKISELEAKVGDTISFQSIQLTNGSRINLNENNNWLIGLEE 348

  Fly   404 L------NLAVNGQGINQPSMLGSATSNLRDPIYRSLLFRIY--DLLKSY---------ENENIF 451
            |      .|||: :.|....:|...|      |.||..|..|  .||.||         .|:..|
  Fly   349 LFPYDWTQLAVD-EVIETNILLDIRT------IVRSEDFYYYAERLLDSYRWYRQVFQPNNQKTF 406

  Fly   452 --PDVGGRETPKIVDIQVSRLVTFEETMTTDLINLI-DQQLLLSHRNNLQFLRRNLVARQHRLNH 513
              .|:      :|.|:|::.|:|:::.:..|:.|:: .|...|:.:....|   .|..||.||.|
  Fly   407 IPSDL------RIDDMQITPLITYDQPVDVDISNILAAQHFYLAGQFVWPF---TLQHRQFRLQH 462

  Fly   514 DPFSIGLDIVAPENLVVEARMYLSLPN-----QLRLRLHLDSFKCSLKRGLNHFERQFPTAISKP 573
            ..||..|.|.:.:......|::|:...     |......||||...:..|||...|:     ||.
  Fly   463 KDFSYNLLISSNKTQSTIFRVFLTTSERGGNIQREPFYQLDSFLTVIYPGLNRITRE-----SKE 522

  Fly   574 ---------TLSELY---------EADYASTDVTTSNRFPPHLQLPR-GTGDGLKLQLLV----- 614
                     :.:|||         |.|:.....|.:..||..|.||| |.|:.|||:||:     
  Fly   523 FKGLAGDHISYTELYQFVKLAERDEFDFPLNISTANCAFPRRLILPRGGLGNPLKLRLLIVASVY 587

  Fly   615 --------EL--------SEWNGLESHF--------DGASVTVLAKTL--KDVIIFH 645
                    ||        |.|:.|...:        |..:|.:....:  |||.|.|
  Fly   588 DFRARQENELNCDFSQGVSRWDELPLGYPFERFLEDDALAVEISGDHVFWKDVHILH 644

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8100NP_001261825.1 Hemocyanin_N 41..163 CDD:281684 43/126 (34%)
Hemocyanin_C 444..>621 CDD:281685 61/234 (26%)
CG7320NP_649034.3 Hemocyanin_N 28..149 CDD:281684 43/125 (34%)
Hemocyanin_M 157..>282 CDD:278784 27/170 (16%)
Hemocyanin_C 400..644 CDD:281685 66/258 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C310624996
eggNOG 1 0.900 E1_28IXN
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11511
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.