DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8100 and PPO2

DIOPT Version :8

Sequence 1:NP_001261825.1 Gene:CG8100 / 39565 FlyBaseID:FBgn0036410 Length:648 Species:Drosophila melanogaster
Sequence 2:NP_610443.1 Gene:PPO2 / 35910 FlyBaseID:FBgn0033367 Length:684 Species:Drosophila melanogaster

Alignment Length:685 Identity:158/686 (23%)
Similarity:267/686 (39%) Gaps:194/686 (28%)


  Fly    49 NLLIQVHKPLLHEELITM--GSQLN--DDPDSYKEGTWRYI-KDFRERVH---QNRVPGPFVILN 105
            |||:....|   .|.:.|  |.::.  |.|||:....:|.| .:.:.||.   :.|||...:.:.
  Fly     6 NLLLLFDHP---TEPVFMDKGKRVTVFDVPDSFLTDRYRPISNEVQSRVGDKVEQRVPVREISIP 67

  Fly   106 QL--------DEEMPL----------NLLGIYRFLTM-AVDWTSFQRNACFARIHFHPLLFVNAL 151
            .|        ||:..|          .|:.|  |:.| :||  ..|..|.:||...:|:||..||
  Fly    68 DLRIPMSLGRDEQFSLFLPKHRRIAGRLIDI--FMNMRSVD--DLQSVAVYARDRVNPVLFNYAL 128

  Fly   152 QMAVEEREDTKDLRMPAMYEVLPQLYFEKEVILTAQEVTWNQLSPIRLVTPKRRWIDILLGYRNP 216
            .:|:..|.||:.|.:|:..:..|..:.:.:||...:|.::       :|.|         |.|.|
  Fly   129 SVALLHRPDTQGLDLPSFSQTFPDRFIDSQVIRKMREESF-------VVQP---------GSRMP 177

  Fly   217 KQPWMEEEPIPTDPLI--IDNARKVAYLSLDLELN-SHWNSLITRLIISIEEGKEKTNEPIIIDG 278
                   ..||.|...  :|...::.|...||.:| .||:   ..|:...|.            .
  Fly   178 -------ITIPRDYTASDLDPEHRLWYFREDLGINLHHWH---WHLVYPFEA------------S 220

  Fly   279 DRLVAFRGSFDEVNFKKHLALGSHFHNTKLYLYNLHQFVAALSMED-LATG--QKSTELI----Y 336
            ||.:..:....|:.:..|..:.:.: |.:.:..||.:.:...::.| :|.|  .|...|:    :
  Fly   221 DRSIVAKDRRGELFYYMHQQVIARY-NAERFSNNLARVLPFNNLRDPIAEGYFPKMDSLVASRAW 284

  Fly   337 PPLMTT---GGVPYKGTSLNIEAVRGIIDLTIDGLKDKIEMAVKHNNHAMD------------NL 386
            ||...:   ..:..:...||:|    |.||  :..:|:|..|: |....||            .:
  Fly   285 PPRFESTRLSDLNRESDQLNVE----IGDL--ERWRDRIYEAI-HQGFVMDERGNRVPLDEATGI 342

  Fly   387 SIAGGIIGNNYLHICRQL--NLAVNGQGI----NQPS--------MLGSATSNLRDPIY---RSL 434
            ...|.:|.::.|...|.|  :|..||...    :.|:        ::|..::.:|||::   .|.
  Fly   343 DTLGNMIESSILSPNRVLYGDLHNNGHTFISYAHDPTSKHLESFGVMGDVSTAMRDPVFYKWHSY 407

  Fly   435 LFRIYDLLKS-----YENENIFPDVGGRETPKIVDIQV-------SRLVTFEETMTTDLINLIDQ 487
            :.||:...||     .||:..:|.|      .|..|||       :.|.||.:....|:....| 
  Fly   408 IDRIFQEHKSRLPAYTENQLNYPGV------SIAGIQVDTNGGRPNNLTTFWQQSDVDMSRGFD- 465

  Fly   488 QLLLSHRNNLQFL-RRNLVARQHRLNHDPFSIGLDI---------------VAPENLVVEARMYL 536
                       || |.|:.||...|.|.||:..:.:               :||:|  .|....:
  Fly   466 -----------FLPRGNVFARFTHLQHLPFTYTISLNNDSGAQRFGYVRIFMAPKN--DERGQPM 517

  Fly   537 SLPNQLRLRLHLDSFKCSLKRGLNHFERQFPTAISKPTLSELYEADYASTDVTTSNR-------- 593
            .:.:|..:.:.||.|..||..|.|...|:  :..|..|:.  :|..:.:.|   :||        
  Fly   518 LMRDQRSMMIELDKFVTSLNPGPNTIRRR--STESSVTIP--FERTFRNLD---ANRPAAGTPEE 575

  Fly   594 ---------FPPHLQLPRGTGDGLKLQLLVELSEW 619
                     :|.|:.:|:|..:||:..|.:.:|.:
  Fly   576 LEFNFCGCGWPNHMLVPKGLPEGLQCVLFIMVSNY 610

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8100NP_001261825.1 Hemocyanin_N 41..163 CDD:281684 41/141 (29%)
Hemocyanin_C 444..>621 CDD:281685 51/222 (23%)
PPO2NP_610443.1 Hemocyanin_N 19..140 CDD:281684 36/125 (29%)
Hemocyanin_M 150..412 CDD:278784 63/308 (20%)
Hemocyanin_C 421..675 CDD:281685 50/218 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C310626293
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11511
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.