DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8100 and Lsp1beta

DIOPT Version :8

Sequence 1:NP_001261825.1 Gene:CG8100 / 39565 FlyBaseID:FBgn0036410 Length:648 Species:Drosophila melanogaster
Sequence 2:NP_001285556.1 Gene:Lsp1beta / 33274 FlyBaseID:FBgn0002563 Length:789 Species:Drosophila melanogaster

Alignment Length:709 Identity:152/710 (21%)
Similarity:282/710 (40%) Gaps:192/710 (27%)


  Fly    43 RQYFLLNLLIQVHKPLLHEELITMGSQLNDDPDSYKEGTWRYIKDFRE--RVHQNRVPGPF---V 102
            :|.||..::.:|..||:.|:.|..|.:...: :||......|:|.|.|  :.|.....|.|   :
  Fly    35 KQKFLFEIVYRVEDPLMFEDHIKQGEKFYFE-ESYYTHYDMYMKKFFEAYKAHALLPKGEFFGAL 98

  Fly   103 ILNQLDEEMPLNLLGIYRFLTMAVDWTSFQRNACFARIHFHPLLFVNALQMAVEEREDTKDLRMP 167
            :::...:..     |::.|...|.||.:|..|..:||:|.:..:||.||.|||..|.|...|.:|
  Fly    99 VMSHAKQAR-----GLFNFFYYAKDWETFAANVAWARMHVNEGMFVYALTMAVIHRNDFHGLMLP 158

  Fly   168 AMYEVLPQLYFEKEVILTAQEVTWNQLSPIRLVTPKRRWIDI----------------------- 209
            ::||:.||.:|..:.:..|::..:...  :::...::.::|:                       
  Fly   159 SIYEIFPQFFFNSKFVFEAEKFDYEMW--MKMTMYEKEYMDVYYKTNGYDYSTMYRSSDYTYMKD 221

  Fly   210 --------LLG-----------------YR-NPKQPWM------EEEPIPTDPL----IIDNARK 238
                    |:|                 |. |.:..|:      ::..:|.|..    :.:...|
  Fly   222 FKTWQWWKLMGLGEHWYTEDKFILRENIYEFNQETKWLSMMKDVKKFYMPVDYTRDLNLYNKESK 286

  Fly   239 VAYLSLDLELNSHWNSLITRLIISIEEGKEKTNEPIIIDGDRLVAFRGSFDEVNFKKHLALGSHF 303
            ::|.:.||..|::|..|             ..:....:||:       :||..|.::        
  Fly   287 LSYFTEDLGWNAYWYYL-------------NMDYSFFLDGN-------TFDLKNDRR-------- 323

  Fly   304 HNTKLYLYNLHQFVAALSMEDLATG---------QKSTELIY-PPLMTTGGVPYK--------GT 350
              .:.:|||:||.::...||.|:.|         .:..|:.| |.|:...|:.|.        .|
  Fly   324 --GEWWLYNVHQLLSRYYMERLSHGFGEIPEFSWYQQIEMGYDPQLIYYNGIGYSFRKNYYEMET 386

  Fly   351 SLN----------IEAVRGIIDL---------TIDGLK-DKIEM---AVKHNNHAMDNLSIA-GG 391
            ..|          ::.:..|:::         |||..| :.||.   .::.|..|||.:... ..
  Fly   387 YANYDMLDKITGFLKRIHNIVEMGYYKTADGHTIDLRKPEAIEFIGNMLQGNVDAMDKMFYQFWY 451

  Fly   392 IIGNNYLHICRQLNLAVNGQGINQPSMLGSATSNLRDPIY-------RSLLFRIYDLLKSYENEN 449
            ::.:.|........:.|      .|:::.:..:.:|||:|       ..:.|:....|..|..|.
  Fly   452 MLAHMYFADADYYQMDV------YPNVMLNFETMMRDPMYYMFYKSIAQVYFQFMHYLPKYTKEQ 510

  Fly   450 -IFPDVGGRETPKIVDIQVSRLVTFEETMTTDLINLIDQQLLLSHRNNLQFLRRNLVARQHRLNH 513
             :.|.|    |.|  :::||.|.|:.:.:..|:.|:::.:::......:..:  :|.|||.||||
  Fly   511 LLMPGV----TMK--NVEVSDLTTYFDLVDFDVTNMLNDKMIFQDGKFVWDM--SLFARQMRLNH 567

  Fly   514 DPFSIGLDIVAP--ENLVVEARM---------YLSLPNQLRLRLHLDSFKCSLKRGLNHFERQ-- 565
            .||:....|.:.  |.:|:.|.:         .:||.......:.:|.|...||.|.|...|:  
  Fly   568 KPFTYTYTIESEKVEKVVIRAFLGPKFDEFGKVISLAENRMNFMEIDEFYYELKAGTNKITRKSS 632

  Fly   566 --FPTAISKPTLSELY---------EADYASTDVTTSN-RFPPHLQLPRGTGDGLKLQL 612
              :.|...:.|.:|||         :.|: ..|::..: .||..|.||.|...|:.:|:
  Fly   633 EFYWTVKDRTTYTELYYYTMMAFDGKYDF-PLDISEPHCGFPDRLVLPMGWQKGMPMQM 690

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8100NP_001261825.1 Hemocyanin_N 41..163 CDD:281684 37/125 (30%)
Hemocyanin_C 444..>621 CDD:281685 50/196 (26%)
Lsp1betaNP_001285556.1 Hemocyanin_N 32..154 CDD:281684 37/125 (30%)
Hemocyanin_M 161..496 CDD:278784 61/373 (16%)
Hemocyanin_C 505..755 CDD:281685 50/196 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C310625581
eggNOG 1 0.900 E1_28IXN
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11511
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.