DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8100 and Lsp1alpha

DIOPT Version :8

Sequence 1:NP_001261825.1 Gene:CG8100 / 39565 FlyBaseID:FBgn0036410 Length:648 Species:Drosophila melanogaster
Sequence 2:NP_511138.2 Gene:Lsp1alpha / 32199 FlyBaseID:FBgn0002562 Length:816 Species:Drosophila melanogaster

Alignment Length:742 Identity:169/743 (23%)
Similarity:282/743 (38%) Gaps:231/743 (31%)


  Fly    43 RQYFLLNLLIQVHKPLLHEELITMGSQLNDDPDSYKEGTWRYIKDFRE--RVHQNRVPGPFVILN 105
            :|.||..::.:|..||:.||.|.||.|...|.:.|.... .|::.|.|  :.|.....|.|  ..
  Fly    35 KQKFLFEIVYRVEDPLMFEEYIAMGKQFYFDKEHYTHFD-LYMEKFFEAHKAHALLPKGEF--FG 96

  Fly   106 QLDEEMPLNLLGIYRFLTMAVDWTSFQRNACFARIHFHPLLFVNALQMAVEEREDTKDLRMPAMY 170
            .|.:.......|::.|...|.||.:|..|..|||:||:..:||.||.:||..|:|...|.:||::
  Fly    97 ALVKHHAKQARGLFNFFYYAKDWETFMTNVAFARMHFNEGMFVYALTLAVIHRDDFHGLVLPAIH 161

  Fly   171 EVLPQLYFEKEVILTAQEVTWNQLSPIRLVTPKRRWIDIL----------LGYR----------- 214
            |:.||.:|..:.::.|::..:.......|.  ::.::|:.          .||:           
  Fly   162 EIFPQFFFNSKFVMEAEKFDYEMWMKTSLY--EKEYMDVYHKIPTFSSYEHGYKQGMAYGYGKTH 224

  Fly   215 -------------------------------------------------------NPKQPWM--- 221
                                                                   |.:..|:   
  Fly   225 GHGQTYEHEFGSMYQTSDYMYMKDFKTWQWWKLMGLGEHWYSESNYILRENIYEYNQESNWLTMM 289

  Fly   222 ---EEEPIPTD---PLIIDNAR-KVAYLSLDLELNSHWNSLITRLIISIEEGKEKTNEPIIIDG- 278
               ::..:|.|   .|.:.|.. |::|.:.||..||:|..|             ..:....:|| 
  Fly   290 KDVKKFYMPVDYSRDLYLYNEESKLSYFTEDLGWNSYWYYL-------------NMDYSFFLDGK 341

  Fly   279 ------DRLVAFRGSFDEVNFKKHLALGSHFHNTKLYLYNLHQFVAALSMEDLATGQ-------- 329
                  ||    ||.:                    :|||:||.::...||.|:.|.        
  Fly   342 TFGLQNDR----RGEW--------------------WLYNVHQLLSRYHMERLSHGLGEIPQFSW 382

  Fly   330 -KSTELIY-PPLMTTGGVPYK--------GTSLNIE----------AVRGIIDL----TIDG--- 367
             ...|:.| |.|:...|:.|.        .|..|.|          .::.|::|    |.||   
  Fly   383 FHQIEMGYDPQLIYYNGIGYSYRKNYYELETYGNFEMLDKITGFQQRIQNIVELGYYQTTDGHMI 447

  Fly   368 ---LKDKIEM---AVKHNNHAMDNLSIA-GGIIGNNYLHICRQLNLAVNGQGINQPSMLGSATSN 425
               ..:.||:   .::.|..|:||:... ..::.:.|........:.|      .|:::.:..:.
  Fly   448 DLRKPESIEIIGNMLQGNVDAIDNIFFQFWYMLAHMYFADTHYYQMEV------YPNVMLNFETM 506

  Fly   426 LRDPI----YRSL---LFRIYDLLKSYENEN-IFPDVGGRETPKIVDIQVSRLVTFEETMTTDLI 482
            :|||:    |:|:   .|:....|..|..|. :.|.|      .:..::||.|||:.:.:..|:.
  Fly   507 MRDPMFYMFYKSIAQVYFQFMHHLPKYTKEQLLMPGV------TLKHVEVSELVTYFDLVDFDVT 565

  Fly   483 NLIDQQLLLSHRNNLQFL-RRNLVARQHRLNHDPFS--IGLDIVAPENLVVEA----------RM 534
            |:::.:::. |..  ||| .::|.|||.||||.|||  ..:|....|.:|:.|          ||
  Fly   566 NMLNGKMVF-HEG--QFLWDKSLFARQMRLNHKPFSYTYTIDSARDEKVVIRAFLGPKFDEYGRM 627

  Fly   535 YLSLPNQLRLRLHLDSFKCSLKRGLNHFERQFP----TAISKPTLSELY---------EADYAST 586
            .....|::.. :.:|.|..:||.|.|...|:..    |...:.|.:|||         :.|| ..
  Fly   628 ISLTDNRMNF-MEIDEFTYTLKTGSNLITRKSTDFAWTVKDRTTYTELYYYTMMAFDGKYDY-PL 690

  Fly   587 DVTTSN-RFPPHLQLPRGTGDGLKLQL 612
            |:|..: .||..|.||.|...|:.:|:
  Fly   691 DLTEPHCGFPDRLVLPMGWKKGMPMQM 717

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8100NP_001261825.1 Hemocyanin_N 41..163 CDD:281684 41/122 (34%)
Hemocyanin_C 444..>621 CDD:281685 57/198 (29%)
Lsp1alphaNP_511138.2 Hemocyanin_N 32..154 CDD:281684 41/122 (34%)
Hemocyanin_M 287..523 CDD:278784 55/279 (20%)
Hemocyanin_C 532..782 CDD:281685 57/198 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C310625548
eggNOG 1 0.900 E1_28IXN
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11511
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.