DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nprl3 and nprl-3

DIOPT Version :8

Sequence 1:NP_001261818.1 Gene:Nprl3 / 39550 FlyBaseID:FBgn0036397 Length:610 Species:Drosophila melanogaster
Sequence 2:NP_501396.1 Gene:nprl-3 / 185331 WormBaseID:WBGene00018072 Length:511 Species:Caenorhabditis elegans

Alignment Length:615 Identity:149/616 (24%)
Similarity:253/616 (41%) Gaps:146/616 (24%)


  Fly     9 AVILVYFDSKGDRLLYRYPYQTLGQTEVANDEQRKSRKRNP-YAVANTDDLLQTPTH-LGAAKSQ 71
            ||:.......|::::..||::.......:.|.|..|  .|| ..|......::.|:: .|...::
 Worm    16 AVMCFLTGQSGEKIVSIYPHRKPATKAPSKDPQPSS--SNPGQCVKPVLTSVKDPSYGFGRVDTE 78

  Fly    72 GQLQ-GFADEVLSALFAVKPQLCNQKFELKLNDVRFVSHPTLIPQKEQRSGPMAKQQMLINIVFA 135
            ..:. |    :|:.:|..:...||..|::|:|:.|||::    |:..:..|.....|  |:||||
 Worm    79 FDMSLG----MLAYVFKTQEIACNDGFDMKINNQRFVAY----PKTWKARGESTNYQ--ISIVFA 133

  Fly   136 LHAQASYSIVKCYHELSKRLGLALKFEEQRSGYLTEQTAQMARTHDEQQQQPLERTLELIAERCS 200
            |...........|..||.::.::|...:...|:|..:........:..:..|||.    .|:...
 Worm   134 LKNGCEQHTASAYQTLSNKIAVSLVMLQNYFGFLEREDKWADNAEEPNKDHPLEE----FAKTSF 194

  Fly   201 LAQALRSIFHDLCTTGLLSTSLNHNLTLCFCLPAKAHQLHK-----KGSMVDPETIDRCLRALKP 260
            :.|.|..:|.::...|.:...|.:.:.|.||  .:||.|.|     ||.    :.||..:|.:||
 Worm   195 IVQPLAEMFEEVRNRGNIHKYLINFVELGFC--DEAHALTKLNVVPKGR----QEIDEIVRKMKP 253

  Fly   261 YHGMLLLVDFAELLDCVPPTGARMLWQLVDVYDPLISLQSMSSNADLSIEHVYKLVSHLVYWAKA 325
            |||:|||.|.....|..|     ::.:|:....|..|:..||:.:.:.|..|:.::.||:.|.:|
 Worm   254 YHGILLLEDVWPTPDANP-----IVAKLLSHCSPDRSILDMSTASGIPIFEVFMIIRHLLQWTRA 313

  Fly   326 TIIYPLCETNVYVIAPD-APLHTKSHLVEKFSARFAG-MSLFEVISDFSLPTSIG---HLTTPLQ 385
            .:|||||.||:|..|.. .||   ..:.|||:|:|.. :.|...::.|:.|.::.   ....||.
 Worm   314 ILIYPLCNTNIYTSATSPQPL---DKMAEKFTAQFGNTIHLAAGLAHFNPPKTLDTFIRKNLPLH 375

  Fly   386 QPARQGILAQMVIWMLQHHLLMQLHTY--------VQFMPSEDEFGDSASCSNHLRDAISDEEGD 442
            :   ||:.|::|:.:|:|.:|||||.:        :..:|...|                     
 Worm   376 E---QGVRAKLVVALLRHQMLMQLHQFYYILKPYSIAILPEPKE--------------------- 416

  Fly   443 QEPDADELHGSMLSMSSHPLPVPAVLVGGHRREASE--DHSSLASDNIAVQPSSSHKSNFSITAS 505
                                |.||        |.::  :.|:|.:|                ...
 Worm   417 --------------------PCPA--------EFTKIIEESTLPND----------------VKG 437

  Fly   506 MSTDNCDSLDSMEDEQKLKELLQVFSDADRAAIRRIPASANVDDLSLLVKLYQMGYFKSEHHLEE 570
            :..|.|            .|:|:..|   .|:::|        .|||.||:..|  ....|||||
 Worm   438 VVADIC------------AEMLETTS---YASVKR--------TLSLFVKVAPM--MDGNHHLEE 477

  Fly   571 IMYFENLRRSQLLQLLDKFRDVLIIYETED 600
            |.|..||.|:::..:...|:.|:..:...|
 Worm   478 IKYKNNLDRTEIEGVFVSFKLVIATFRRPD 507

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nprl3NP_001261818.1 NPR3 76..413 CDD:305178 101/355 (28%)
nprl-3NP_501396.1 NPR3 <253..402 CDD:305178 53/160 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C157966203
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 1 1.000 H8091
Inparanoid 1 1.050 164 1.000 Inparanoid score I2792
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D260717at33208
OrthoFinder 1 1.000 FOG0003749
OrthoInspector 1 1.000 T476888
orthoMCL 1 0.900 OOG5_129997
Panther 1 1.100 LDO PTHR13153
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R838
TreeFam 00.000 Not matched by this tool.
1211.940

Return to query results.
Submit another query.