DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nprl3 and nprl3

DIOPT Version :8

Sequence 1:NP_001261818.1 Gene:Nprl3 / 39550 FlyBaseID:FBgn0036397 Length:610 Species:Drosophila melanogaster
Sequence 2:XP_012825411.1 Gene:nprl3 / 100124838 XenbaseID:XB-GENE-5818915 Length:580 Species:Xenopus tropicalis

Alignment Length:630 Identity:230/631 (36%)
Similarity:348/631 (55%) Gaps:83/631 (13%)


  Fly     1 METNVNPLAVILVYFDSKGDRLLYRYPYQTLGQTEVANDEQRKSRKRNP---YAVANTDDLLQTP 62
            |..|.:|::||||...|:|::||:|||:|       .|.|.:.|:..||   ||:.||.|....|
 Frog     1 MGENTSPISVILVSSGSRGNKLLFRYPFQ-------RNHEPQLSKTINPRSCYALPNTGDNSDDP 58

  Fly    63 THLGAAK------SQGQLQGFADEVLSALFAVKPQLCNQKFELKLNDVRFVSHPTLIPQKE-QRS 120
            .  |.:|      .:..::||:|.:|:.:.|.|..:|.:|||||:::||||.||||:...: .::
 Frog    59 D--GDSKEPCPLTDEQLVEGFSDVILATILATKSDMCGKKFELKIDNVRFVGHPTLLQHAQVSKT 121

  Fly   121 GPMAKQQ----MLINIVFALHAQASYSIVKCYHELSKRLGLALKFEEQRSGYLTEQTAQMARTHD 181
            .|..|::    :|.|:||||.|.|..|::.|.|.||:|:.:.|:.||:|..|||.:...:....|
 Frog   122 DPSPKREAPTMILFNVVFALRANADPSVINCLHNLSRRIAIVLQHEERRCQYLTREAKLILAIQD 186

  Fly   182 E---------QQQQPLERTLELIAERCSLAQALRSIFHDLCTTGLLSTSLNHNLTLCFCLPAKAH 237
            |         ..|.|...    |..:|.||:.|:..:..|||||::...:|:.|.:.||||   |
 Frog   187 EVTAMSETNGGPQSPFHH----ILPKCKLARDLKEAYDSLCTTGVVRLHINNWLEVSFCLP---H 244

  Fly   238 QLHKKG-SMVDPETIDRCLRALKPYHGMLLLVDFAELLDCVPPTGARMLWQLVDVYDPLISLQSM 301
            ::|..| :.:.|:.|::.|::::|||.:|||.|...||:.:|...:..|.:::.....:.:||.:
 Frog   245 KIHCVGTNFIPPDAIEKSLKSIRPYHALLLLKDEKNLLNDLPLDCSPALVRIIKSASAVKNLQQL 309

  Fly   302 SSNADLSIEHVYKLVSHLVYWAKATIIYPLCETNVYVIAPDAPLHTKSHLVEKFSARFAGMSLFE 366
            :.:|||::..|::|.:|||||.||.|||||||.|||:::|:|.:...|.|.|:||.:|....|..
 Frog   310 AQDADLALLQVFQLAAHLVYWGKAIIIYPLCENNVYMLSPNANVGLYSSLAEQFSHQFPAHDLPS 374

  Fly   367 VISDFSLPTSIGHLTTPLQQPARQGILAQMVIWMLQHHLLMQLHTYVQFM--PSEDEFGDSASCS 429
            |:|.||||.|:..|..||..|.::..|.|||||||||.||:|:||||..:  |:||         
 Frog   375 VLSKFSLPVSLSELKNPLSPPGQEPHLIQMVIWMLQHRLLIQIHTYVCLLVPPNED--------- 430

  Fly   430 NHLRDAISDEEGDQEPDADELHGSMLSMSSHPLPVPAVLVGGHRREASEDHSSLASDNIAVQPSS 494
                  ::..:.:..|.|..:.|..||       .|..|..|         |..:||::.:...|
 Frog   431 ------VASTKDEDTPFAARVGGRSLS-------TPNALSFG---------SPTSSDDMTLTSPS 473

  Fly   495 SHKSNFSITASMSTDNCDSLDSMEDEQKLKELLQVFSDADRAAIRRIPASANVDDLSLLVKLYQM 559
            ...|        |.:.....||..:::..:.||...|..:|.||..|||:.|.:||.:..:|  :
 Frog   474 MDNS--------SAELLPGADSPVNKRATENLLASLSQHEREAILSIPAAQNQEDLKMFARL--L 528

  Fly   560 GYFKSEHHLEEIMYFENLRRSQLLQLLDKFRDVLIIYETEDPAIA 604
            .||:..||||||||.||:||||||.|.||||.||::...|||.|:
 Frog   529 HYFRGRHHLEEIMYNENMRRSQLLMLFDKFRSVLVVTNHEDPVIS 573

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nprl3NP_001261818.1 NPR3 76..413 CDD:305178 140/352 (40%)
nprl3XP_012825411.1 NPR3 76..427 CDD:305178 141/358 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C157973067
eggNOG 1 0.900 E1_KOG3830
Hieranoid 1 1.000
Homologene 1 1.000 H8091
Inparanoid 1 1.050 366 1.000 Inparanoid score I2000
OMA 1 1.010
OrthoDB 1 1.010 D260717at33208
OrthoFinder 1 1.000 FOG0003749
OrthoInspector 1 1.000 T1060960
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R838
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.