DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DCTN1-p150 and tip1

Sequence 1:NP_524061.1 Gene:DCTN1-p150 FlyBaseID:FBgn0001108 Length:1265 Species:Drosophila melanogaster
Sequence 2:NP_593613.1 Gene:tip1 PomBaseID:SPAC3C7.12 Length:461 Species:Schizosaccharomyces pombe

Alignment Length:524 Identity:126/525 (24%)
Similarity:210/525 (40%) Gaps:118/525 (22%)


  Fly     8 VGARVE-LTGKDLLGTVAYVGMTSFAVGKWVGVVLDEPK----GKNSGSIKGQQYFQC--DENCG 65
            :|:.|| :||:  .|.|.|.|......|.:||:.| .|:    |||.|.:.|::||:.  :|..|
pombe     4 LGSVVEVITGE--RGFVRYAGEVENRKGVYVGLEL-LPEFAEFGKNRGVVDGREYFKTKNNEKTG 65

  Fly    66 MFVRPTQLRL---LEAAPGSRRSIEDVSGATPTAAQPTKARLSSS---RTSLSSSRQSLLGSRTQ 124
            :||...:.:|   :.::|..:  |:..:.:......|....|.||   .|::|||          
pombe    66 IFVPFDKCKLASSISSSPSPK--IDGTAASIGMGFPPMSPNLQSSIPRLTNVSSS---------- 118

  Fly   125 LTTSLSERTASSSSIGPRKSLAPQNSKDKESPSTSLAEGAPAASGGNGAASHASSKRASFVETGF 189
              ::||..|.||:::.|.:.:..:..:|      .|.|          ..:|.............
pombe   119 --SNLSMNTISSTALTPTEKILQKRIED------LLYE----------RQNHQQQLEEVLATVDQ 165

  Fly   190 LEILKPQFTPSQPLRSPSFTMPSNSGAEDKVALLEAQKTSAELQAQLADLTEKLETLKQRRNEDK 254
            |:.|...|...|                |:|..|..:            :|.|.|.::|.|||..
pombe   166 LQSLVTNFNDQQ----------------DEVDELRER------------ITLKEERIQQMRNEAS 202

  Fly   255 ERLREFDKMKIQFEQLQE--------FRTKIMGAQASLQKELLRAKQEAKDAIEAKEQHAQEMAD 311
            :|..||   |...|.|:|        :..:|  |:...|.|:..:.:...|.:.:.:|.    .|
pombe   203 QRRFEF---KTTIECLEESSNRAIETYENRI--AELEAQLEMYMSGKSEDDLLFSLQQE----RD 258

  Fly   312 LADNVEMITLDKEMAEEKADTLQLELESSKERIEELEVDLELLRSEMQNKAESAIGNISGGGDSP 376
            .|.|      ..|:.:|:.|||..:..:|....|:|. .:|.....:.|.:..:.....|..|.|
pombe   259 YALN------QVEILQERVDTLMKQKANSSTANEKLS-HMESSSPTLTNASFESPKRGKGSNDLP 316

  Fly   377 -----GLSTYEFKQLEQQNIRLKETLVRLRDLSAHDKHDIQKLSKELEMKRSEVTELERTKEKLS 436
                 ...|.||.::|.:.:|  |.:.:|:.||......|.||.|.|:  |::.|.:. :.||||
pombe   317 ENHPQRRQTLEFYEIEIEVLR--EKVEKLQALSDEKDFYISKLEKSLD--RNDTTPVP-SDEKLS 376

  Fly   437 AKIDELEAIVADLQEQVDAALGAEEMVEQLAEKKMELEDKVKLLEEEIAQLEALEEVHEQLVESN 501
            ....|.|.:|:.:.|       .|..:|||........:::...|.|   ||..:||.|...:|:
pombe   377 NYAAEKENLVSRISE-------LEHTIEQLTINNERDNERMSPAEFE---LETTQEVEENDSDSH 431

  Fly   502 HELE 505
            .:.|
pombe   432 DDEE 435

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DCTN1-p150NP_524061.1 CAP_GLY 8..74 CDD:214997 25/73 (34%)
Dynactin 553..834 CDD:289240
tip1NP_593613.1 CAP_GLY 4..74 CDD:214997 25/73 (34%)
FliE 101..>187 CDD:298840 24/142 (17%)
BBP1_C <140..238 CDD:291921 28/147 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18916
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1398
TreeFam 00.000 Not matched by this tool.
22.130

Return to query results.
Submit another query.