DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DCTN1-p150 and clip3

Sequence 1:NP_524061.1 Gene:DCTN1-p150 FlyBaseID:FBgn0001108 Length:1265 Species:Drosophila melanogaster
Sequence 2:NP_001120145.1 Gene:clip3 XenbaseID:XB-GENE-5806327 Length:534 Species:Xenopus tropicalis

Alignment Length:148 Identity:43/149 (29%)
Similarity:69/149 (46%) Gaps:12/149 (8%)


  Fly     1 MSEKNLKVGARVELTGKDLLGTVAYVGMTSFAVGKWVGVVLDEPKGKNSGSIKGQQYFQCDENCG 65
            ::...:|:|.|: |...:..||:.:.|.|.||.|:||||.||||:|||.||:.|.:||.|....|
 Frog   279 LASLGMKLGDRI-LLDAEKAGTLRFCGTTEFASGQWVGVELDEPEGKNDGSVGGIRYFICPPKQG 342

  Fly    66 MFVRPTQLRLLEAAPGSRRSIEDVSGATPTAAQPTKARLSSSRTSLSSSRQSLLGSRTQLTTSLS 130
            :|           ||.|:.|.......:...:.|...|:..||.:....::.....:..|:....
 Frog   343 IF-----------APVSKISKAPDQPPSSVTSTPRTPRVDFSRVTGKGRKEKKATHKKSLSVGSL 396

  Fly   131 ERTASSSSIGPRKSLAPQ 148
            ::......||.:..:|.|
 Frog   397 DKEGLKIDIGDQVLVAGQ 414

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DCTN1-p150NP_524061.1 CAP_GLY 8..74 CDD:214997 29/66 (44%)
Dynactin 553..834 CDD:289240
clip3NP_001120145.1 ANK 102..227 CDD:238125
ANK repeat 110..147 CDD:293786
Ank_2 112..218 CDD:289560
ANK repeat 149..185 CDD:293786
ANK repeat 187..218 CDD:293786
CAP_GLY 287..350 CDD:279625 32/75 (43%)
CAP_GLY 406..469 CDD:279625 3/10 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5244
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1398
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.