DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dysc and CG15803

Sequence 1:NP_001261810.1 Gene:dysc FlyBaseID:FBgn0264006 Length:1254 Species:Drosophila melanogaster
Sequence 2:NP_001287388.1 Gene:CG15803 FlyBaseID:FBgn0038606 Length:880 Species:Drosophila melanogaster

Alignment Length:928 Identity:177/929 (19%)
Similarity:300/929 (32%) Gaps:303/929 (33%)


  Fly   307 HGFGICVKGGKDSGLGVYISRIEENSVAERAG-LRPGDTILEVNGTPFTSINHEEALKRCVQILK 370
            :|.|..:.||:.:  ||.|..:....||||.| |:.||.:|::........:.|:.   ...:.:
  Fly    20 NGLGFILVGGRST--GVVIKALTPGGVAERDGRLQLGDHLLQIGEVNLRGFSSEQV---ATVLRQ 79

  Fly   371 SSRQISMTVRAP--------PTLNSTAPL--------------HGFGPPSRDPMYASMAPPLHPQ 413
            :..|:.:.|..|        .||...||:              |.|    ::|.:|:.|      
  Fly    80 TGAQVRLIVARPVEPTAIDYQTLACQAPIIPTKLLSDPEELSRHLF----QNPSFATAA------ 134

  Fly   414 NQAAAAAAAAAASGAGLPFRQTCSWMDRHGRPASPPMEYGGRRSERRDRIRRVELLIEPGQSLGL 478
              .|||||||||:|:|       |..|..|         ||              :::....:||
  Fly   135 --VAAAAAAAAAAGSG-------SDGDVGG---------GG--------------VLDVASLVGL 167

  Fly   479 MIRGGVEYGLGIFVTG-------VDKDSVADRSGLMIGDEILEVNGQSFLDVTHDEAVGQLKYHK 536
             :|||...|..:....       :....:::.:|.:....:..:.|.....:..|...|| :...
  Fly   168 -VRGGPAEGTELSAVEPQPSAAVLQLQQLSELAGDLADFPLPPIPGGGGHSMVTDSNAGQ-RPCP 230

  Fly   537 RMSLVIRDVGKVPHSCTSIEMEPWDAYSPTGTRAR----RKGQIATMVEEKARSLLPRHHFASLS 597
            |:.|.|     ||.|..|....|.....|..|:.|    :...|.|::.:..|.||......|.|
  Fly   231 RLDLDI-----VPFSILSPPPRPALQMLPLETQWRCVQDQNRHIETVIADSKRKLLANEDGGSAS 290

  Fly   598 YYIAEYSAKAMTIDAFVAVLLEMLDTYEKHTLVTEIRELVFPEDRTRYDELVYRRERDPYSVDRH 662
                  ::.:.:.|::       :|:.|..|.|.|:.:.|:....|....:....:.....| :.
  Fly   291 ------ASGSGSPDSY-------MDSPETETYVVELHKNVYGLGITVAGYVCEEEDLSGIFV-KS 341

  Fly   663 RRKGDPARDLPVTADDLE----IIAATGRSPSSDSGLGMTVTDIYKRPALQLPHRPMSAGPILH- 722
            ..:|..|.    |:..::    |:|..|||.|     |:|     ...|::|..   :...::| 
  Fly   342 IIEGSAAE----TSGQIQINDRIVAVDGRSLS-----GVT-----NHQAVELLR---NTDIVVHL 389

  Fly   723 ------RSQPASHYQTGSNQSSSSLSP-------PQQQQQQQQHYQPHHASLRHLGGIGGNVGSG 774
                  |.:...|.|....:...:.:|       .:.|.|:.|...|...|:..|..        
  Fly   390 TLERFLRGRKYEHLQVALTEIKGTSAPSGLDRSQDKDQDQESQLSMPGSPSIATLSW-------- 446

  Fly   775 RHHHHPLGPSQLKFRQTKDNQQQEYGCDEHRTRRGSETLLPEY-----------EPDAEQELATK 828
                  |.|..|             ..|...| .|.|.:..||           |..:...:.:.
  Fly   447 ------LPPKSL-------------DADSIAT-EGDEAVDAEYVGISGAEDEFIELPSRDTVESN 491

  Fly   829 LSRSFDMKEEGGTLLGDKGVRRHQSMQRLS-------AEQNGGSTTEQTHEHNPNVVPDHRGNLH 886
            :|...|..:..|.|..|: |.|...:..|:       |:.:|..|.||..|.........:|:..
  Fly   492 MSHVLDRSDHSGGLTKDQ-VPRISPIVPLTNGRSLILADDSGNDTDEQCAEPETETAQARKGSKP 555

  Fly   887 IT--------------------------------VKKTKPI----------LGIAIEGGANT--- 906
            .|                                ||...|.          |||::||..:.   
  Fly   556 ETERVKDLGDTKTDTDPDPDLDPGQMPTPTNEAPVKAASPTAASLRVAWKSLGISLEGTVDVECG 620

  Fly   907 --KHPLPRIINIHENGAAFEAGGLEVGQLILEVDGTKVEGLHHQEVARLIAECFANREKAEITFL 969
              |.|...|.:|..:|.....|.|..|..:|:|:..|::||.|.||.:::.|.            
  Fly   621 IEKRPHHYIRSILADGPVGRQGILRPGDELLQVNEHKLQGLRHIEVVKILKEL------------ 673

  Fly   970 VVEAKKSNLEPKPTALIFLEAXHLLALPASDPLERQKLEFLYEWGIDLTETPKPMPTPIPLTKAK 1034
                      |....|:.....|:.::                  |:.::.|:...|       :
  Fly   674 ----------PARVKLVCARGTHVPSV------------------INTSQNPEAFET-------R 703

  Fly  1035 NPPPLPHELHNNINSQYGSSAALSNHQPHQHTHPHPQQQQQQQQHSNTKTPNTNSNKTQGTPTTG 1099
            :..|..|:...|:.|                         :.|..|:..|.:|.:....|....|
  Fly   704 SLLPGGHQSLQNLLS-------------------------KAQSESSLYTSSTATLTDAGAAAGG 743

  Fly  1100 TGAATTGSKQQQQPGNTT 1117
            :|....|..:.:...|.:
  Fly   744 SGGTAGGGARSKSLENVS 761

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dyscNP_001261810.1 PDZ_signaling 294..380 CDD:238492 19/74 (26%)
PDZ_signaling 466..543 CDD:238492 14/84 (17%)
HN_L-whirlin_R2_like 573..653 CDD:259823 15/80 (19%)
PDZ_signaling 886..971 CDD:238492 26/132 (20%)
CG15803NP_001287388.1 PDZ_signaling 17..89 CDD:238492 19/74 (26%)
PDZ 307..393 CDD:214570 20/104 (19%)
PDZ_signaling 605..680 CDD:238492 24/97 (25%)
PDZ 773..858 CDD:214570
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.