DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LEPR and sdk

Sequence 1:NP_002294.2 Gene:LEPR HGNCID:6554 Length:1165 Species:Homo sapiens
Sequence 2:NP_001284756.1 Gene:sdk FlyBaseID:FBgn0021764 Length:2265 Species:Drosophila melanogaster

Alignment Length:1280 Identity:240/1281 (19%)
Similarity:419/1281 (33%) Gaps:468/1281 (37%)


Human    18 VITAFNLSYPITPWRFKLSCMPPN--STYDYFLLPAGLSKNTSNSNGHYETAVEPKFNSSGTHFS 80
            ::....|.||...:|:....:|..  |:..::...:...::.    |.|:....   |.:|:.||
  Fly    92 ILQCHALGYPQPTYRWLKDGVPVGDFSSSQFYRFHSTRREDA----GSYQCIAR---NDAGSIFS 149

Human    81 NLSKTTFHCCFRSEQDRNCSLCADNIEGK-TFVS--------------TVNSLVFQQIDANWNIQ 130
            ..|....         ....:..:..||: |.:|              .|.|:::|..|...|. 
  Fly   150 EKSDVVV---------AYMGIFENTTEGRLTVISGHPAIFDMPPIESIPVPSVMWQSEDGPLNY- 204

Human   131 CWLKGDLKLFICYVESLF-----KNLFRNYNYK--------------VHL-------LYVLPEVL 169
                 |:|....:...|.     :|..:.|..|              |||       :.|.||::
  Fly   205 -----DIKYAFTHANQLIILSADENDRKGYRAKAINTQLGKEESSAFVHLNVSGDPYIEVAPEII 264

Human   170 EDSPLVPQKGSFQMVHCNC-----SVHECCECL-----VPVPTA----KLND----TLLM----- 211
            .....|..|....:|...|     .:|| .|.|     :.|.||    .|||    ||.:     
  Fly   265 VRPQDVKVKVGTGVVELQCIANARPLHE-LETLWLKDGLAVETAGVRHTLNDPWNRTLALLQANS 328

Human   212 -------C-LKITSGGVIFQSPLMSVQPINMVKPDPPL-------------GLHMEITDD--GNL 253
                   | :::.|||....|....:|.:     :|||             |..:::|.|  |. 
  Fly   329 SHSGEYTCQVRLRSGGYPAVSASARLQIL-----EPPLFFTPMRAETFGEFGGQVQLTCDVVGE- 387

Human   254 KISWSSPPLVPFPLQYQVKYSENSTTV----------------------------------IREA 284
                      |.|   |||:..|:.:|                                  |.||
  Fly   388 ----------PTP---QVKWFRNAESVDAHIESGRYTLNTDNTLVIKKLILDDAAMFQCLAINEA 439

Human   285 DKIVSATSLLVDSILPGSSYEVQVRGKRLDGPGIW-------------------SDWSTPRVFTT 330
            .:..::|.|.|      .:...:.|.|||..|.|.                   ||......|.:
  Fly   440 GENSASTWLRV------KTKTAKNRVKRLAQPRILRVRASHAGLGSEKGSESGSSDRRKEFRFAS 498

Human   331 QDVIYFPPKILTSV-GSNVSFHCIYKKENKIV--PSKEIVWWMNLAEKIPQSQYDVVSDHVSKVT 392
            ..::..||:.:|:: |.:.:..|      :.|  |:..|.|..|..:.:         |..|:|.
  Fly   499 APIMELPPQNVTALDGKDATISC------RAVGSPNPNITWIYNETQLV---------DISSRVQ 548

Human   393 FFNLNETKPRGKFTYDA-VYCCNEHECHHRYAELYVIDVNINISCETDGYLTKMTCRWSTSTIQS 456
            .....:.......:.|| :|.|              :..|...|.:.:.||:.:.   .|..||.
  Fly   549 ILESGDLLISNIRSVDAGLYIC--------------VRANEAGSVKGEAYLSVLV---RTQIIQP 596

Human   457 LAESTLQLRYHRSSLYC--SDIPSI-------------HPISEPKDCYLQSDGFYECIFQPIFLL 506
            ..::|:.|.. .::|.|  |..||:             .|||..:...:|:||..|         
  Fly   597 PVDTTVLLGL-TATLQCKVSSDPSVPYNIDWYREGQSSTPISNSQRIGVQADGQLE--------- 651

Human   507 SGYTMWIRINHSLGSLDSPPTCVLPD-----------SVVK-PLPPSSVKAE-------ITINIG 552
               ...:|.: .:||.    .||:..           ||:: |.|||:||.|       .:||  
  Fly   652 ---IQAVRAS-DVGSY----ACVVTSPGGNETRAARLSVIELPFPPSNVKVERLPEPQQRSIN-- 706

Human   553 LLKISWEKPVFPENNLQFQI-RYGLSGKEV-----------QWKMYEVYDAKSKSVSLPVPDLCA 605
               :|| .|.|..|:   .| ::.:..:||           .| :.|:.:..:....:.:.:|.|
  Fly   707 ---VSW-TPGFDGNS---PISKFIIQRREVSELGPVPDPLLNW-ITELSNVSADQRWILLENLKA 763

Human   606 VYAVQVRCKRLDGLGYWSNWSNPAYTVVMDIKVPMRGPEFWRIINGDTMKKEKNVTLLWKPLMKN 670
            ....|.|...::.:|..|. |.|:..|.:..:.| .||....:.:..:|.:   :...|:|.::.
  Fly   764 ATVYQFRVSAVNRVGEGSP-SEPSNVVELPQEAP-SGPPVGFVGSARSMSE---IITQWQPPLEE 823

Human   671 DSLCSVQRYVINHHT--SCNGTWS-EDVGNHTKFTFL------WTEQAHTVTVLAINSIGASVAN 726
            .....:..|::.:..  ..|..|| :::.|..:..||      |.:  :.|.:.|.|::|..|..
  Fly   824 HRNGQILGYILRYRLFGYNNVPWSYQNITNEAQRNFLIQELITWKD--YIVQIAAYNNMGVGVYT 886

Human   727 FNLTFSWPMSKVNIVQSLSAYP--------LNSSCVIVSWILSPSDYKLM-----YFIIEWKNLN 778
            ..       ||:...:.:...|        :||:.....| ..|:..::.     |.|..|:...
  Fly   887 EG-------SKIKTKEGVPEAPPTNVKVEAINSTAARCRW-TPPNPQQINGINQGYKIQAWQRRL 943

Human   779 EDGEIKWLRISSSVKKYYIHDHFIP----------------IEKYQFSLYPIFM-------EGVG 820
            .|||  |..|...:|.       :|                :||  |:.|.|.:       :||.
  Fly   944 IDGE--WRDIERRMKT-------VPPSLIDPLAEQTAILGGLEK--FTEYNISVLCFTDPGDGVA 997

Human   821 KPKIINSFTQDDIEKH--------QSDAGLYVI-VPVIISSSILLLGT----------------- 859
            ..::. ..|.||:...        .||..:.|: .|...|:.||...|                 
  Fly   998 SSQVA-VMTMDDVPDEVTGLHFDDVSDRSVKVLWAPPRASNGILTGYTVRYQVKDRPDTLKSFNL 1061

Human   860 ------LLISHQRMKKLFWEDVPNPKNCSWAQ-GLNFQKPETFEHLFIKHTASVTCG--PLLLEP 915
                  |.::..:....:|.::     .:|.: |....|           ||::..|  |:|...
  Fly  1062 TADDTELTVNQLQATTHYWFEI-----VAWTRVGSGIPK-----------TATIQSGVEPVLPHA 1110

Human   916 ETISEDISVD------------------TSWKNKDEMMPTTVVSLLSTTDLEKGSVCISDQFNSV 962
            .|.....:::                  |.||.:.:          :..::...::|      .:
  Fly  1111 PTALALSNIEAFSVVLQFTPGFDGNSSITKWKVEGQ----------TARNMTWFTIC------EI 1159

Human   963 NFSEAEGTEVTYEDESQRQPFVKY------ATLISNSKPSETGEE 1001
            |..:||...||     ...||.:|      :.::.:|||||..::
  Fly  1160 NDPDAETLTVT-----GLVPFTQYRLRLSASNVVGSSKPSEATKD 1199

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LEPRNP_002294.2 FN3 237..330 CDD:238020 29/161 (18%)
Lep_receptor_Ig 333..420 CDD:283889 17/91 (19%)
Leptin-binding. {ECO:0000305|PubMed:22405007} 467..484 8/32 (25%)
FN3 537..627 CDD:238020 26/109 (24%)
WSXWS motif 622..626 1/4 (25%)
fn3 741..812 CDD:278470 18/100 (18%)
Box 1 motif 871..879 1/8 (13%)
Required for JAK2 activation. {ECO:0000250|UniProtKB:P48356} 893..898 0/5 (0%)
Required for STAT3 phosphorylation. {ECO:0000250|UniProtKB:P48356} 898..906 2/8 (25%)
sdkNP_001284756.1 Ig 71..157 CDD:299845 13/81 (16%)
I-set 72..150 CDD:254352 12/65 (18%)
Ig 172..245 CDD:299845 12/79 (15%)
IG_like 280..356 CDD:214653 19/77 (25%)
Ig 280..343 CDD:299845 15/64 (23%)
IG_like 375..450 CDD:214653 16/89 (18%)
Ig 378..447 CDD:143165 14/83 (17%)
Ig 506..587 CDD:299845 20/110 (18%)
IG_like 506..587 CDD:214653 20/110 (18%)
I-set 592..682 CDD:254352 22/108 (20%)
Ig 595..682 CDD:299845 21/105 (20%)
FN3 686..789 CDD:238020 27/114 (24%)
FN3 798..893 CDD:238020 20/107 (19%)
FN3 901..1005 CDD:238020 22/117 (19%)
fn3 1011..1094 CDD:278470 12/88 (14%)
FN3 1108..1202 CDD:238020 18/114 (16%)
FN3 1210..1308 CDD:238020
fn3 1317..1402 CDD:278470
FN3 1415..1507 CDD:238020
FN3 1513..1608 CDD:238020
fn3 1617..1708 CDD:278470
FN3 1722..1823 CDD:238020
FN3 1828..1920 CDD:238020
FN3 1927..2016 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.889 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.