DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tgi and R08C7.12

DIOPT Version :8

Sequence 1:NP_729916.1 Gene:Tgi / 39521 FlyBaseID:FBgn0036373 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_001255261.1 Gene:R08C7.12 / 177214 WormBaseID:WBGene00019955 Length:335 Species:Caenorhabditis elegans

Alignment Length:416 Identity:74/417 (18%)
Similarity:126/417 (30%) Gaps:148/417 (35%)


  Fly    32 GGATATSPASSAS--------SASSTASISSASCSSGPS--TSSIVSSAASSHGSLAQVATARAA 86
            |..:.||..||.|        ||..:.||.|:|....||  |:.:..|::.|...:..:.:..|:
 Worm    34 GNTSETSFESSVSVSTNSFDFSADMSRSIDSSSSRMLPSPITNFVTPSSSFSSHQMHDIYSLAAS 98

  Fly    87 AALADQQALASQRAMFYNVQHPQQLEQLHALQAESGNQQMHPQANADPNASSMANSLLWQPWRDL 151
            ...|.........|.     ||....||..|.    |.....|...||:...:..:       |.
 Worm    99 YLQAPPPPYTPTTAF-----HPHNAHQLLLLH----NMTAAVQTPEDPDIDVVGLA-------DT 147

  Fly   152 QQAAAMHHQLYRQQQQQLQLHSEMRATSKV-LTTTKWRRERRQRSAGYQPHEAGNSERERERERD 215
            ....:::.   ::.:::|...:|...:.:: ::||:                             
 Worm   148 TNLVSLND---KEDEEKLDQTTESEESDRISISTTE----------------------------- 180

  Fly   216 REDRDMDSPIDMSVTTGALKQRASPPPPYREPLPGTNYAANSRPSVI-------TQAPPKREPPE 273
                  :.|:|::....:|.   ||......||         |||||       .....:|....
 Worm   181 ------ECPLDLTFKPTSLD---SPTSSTFIPL---------RPSVIIDHHIPKPHTSVRRSMSS 227

  Fly   274 QAHSTDMAMCDIDEHFRRSLGENYAALFAKKSPTPTPTPTPSPSGTPKQQVSPLAYGLPSSTSTA 338
            .:.|......::..||||||...:              |......:.:.:.|||......:|.|:
 Worm   228 VSSSASSTQEEVAAHFRRSLSGKW--------------PKRCKVNSEEARNSPLRRRPSFNTHTS 278

  Fly   339 ASQHYQQQRSPLAKSGWVILEPESLQPELPPPQEEPLPLSLALHRTQTPPSPPPSATGSAPAL-- 401
            .|                                     ||::|..    ||.|..|.||..:  
 Worm   279 VS-------------------------------------SLSVHSV----SPTPPVTSSAQTIIV 302

  Fly   402 -------PTAVSQVMEAAVAGRRILD 420
                   ..:|:.....|:.|:.:.|
 Worm   303 NNHCSDTTLSVADHFRRALLGKGLFD 328

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TgiNP_729916.1 VGLL4 <258..297 CDD:291898 13/46 (28%)
TDU 282..297 CDD:197839 6/15 (40%)
TDU 511..526 CDD:197839
R08C7.12NP_001255261.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_170046
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.