DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10089 and SSH3

Sequence 1:NP_001261803.1 Gene:CG10089 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_060327.3 Gene:SSH3 HGNCID:30581 Length:659 Species:Homo sapiens

Alignment Length:409 Identity:99/410 (24%)
Similarity:156/410 (38%) Gaps:101/410 (25%)


  Fly     7 KVLPGLYVGNYRDSKDHAQLERFKISHIIAIHDSPRRLLPDKH-YLCVMASDTPDQNLSQYFSVC 70
            ::.|.||:|:..::.:..:|:|.:::||:.:........|::. |..|...|.....|..::...
Human   331 RIFPHLYLGSEWNAANLEELQRNRVTHILNMAREIDNFYPERFTYHNVRLWDEESAQLLPHWKET 395

  Fly    71 NDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVANPNAGFQSQL 135
            :.||.|||.:..:||:||..|:|||....:||.|.....:.::||:.|:..|.:|.||.||..||
Human   396 HRFIEAARAQGTHVLVHCKMGVSRSAATVLAYAMKQYECSLEQALRHVQELRPIARPNPGFLRQL 460

  Fly   136 QEFEQFKLSEERRRLRERFPSSALEQLDRTKVATALDNYQELLQNRDICEGNCSRGEKCPTGVCN 200
            |.::.. |:..|:       |...||    ||                  |..|..|.....|..
Human   461 QIYQGI-LTASRQ-------SHVWEQ----KV------------------GGVSPEEHPAPEVST 495

  Fly   201 MDPTKGLFRRRPSNASTHSRLRAQSSNANASSSSLSVSSAAAQSCPTSPKNSPLPI-------VR 258
            ..|.   ....|........:..:.|.|                   :||..|.|.       |.
Human   496 PFPP---LPPEPEGGGEEKVVGMEESQA-------------------APKEEPGPRPRINLRGVM 538

  Fly   259 RSVGNERIPEDEIVLEQPPTTSREAAEYAAAFEDARREQEQRQLQQQQQLSRSQ------RSPRP 317
            ||:.   :.|..:.||....|| :..|..::.|.:..|    .||...||:|::      |.|:|
Human   539 RSIS---LLEPSLELESTSETS-DMPEVFSSHESSHEE----PLQPFPQLARTKGGQQVDRGPQP 595

  Fly   318 VNSSREAPRVSSAGS----RRESAARE---GNGSAQLQRSASTVSGFGVRPRSSPAGLHAYTGSV 375
            ...||::. |:..||    .|..|.:|   |.|..|.:...|:...|....|.            
Human   596 ALKSRQSV-VTLQGSAVVANRTQAFQEQEQGQGQGQGEPCISSTPRFRKVVRQ------------ 647

  Fly   376 PSSVHGSRVDLRDADKGSA 394
             :|||.|      .::|.|
Human   648 -ASVHDS------GEEGEA 659

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 41/133 (31%)
SSH3NP_060327.3 SSH-N 3..259 CDD:212166
DEK_C 272..320 CDD:285919
DSPc 329..464 CDD:238073 41/133 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.