DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10089 and DUSP13

Sequence 1:NP_001261803.1 Gene:CG10089 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:XP_005269940.1 Gene:DUSP13 HGNCID:19681 Length:417 Species:Homo sapiens

Alignment Length:157 Identity:48/158 (30%)
Similarity:84/158 (53%) Gaps:15/158 (9%)


  Fly     4 HMGKVLPGLYVGNYRDSKDHAQLERFKISHIIAIHDSPRRLLPDK----------HYLCVMASDT 58
            |:.:|.|.|::|:...::|.::|.:..|:|:  ::.:..:...|.          .|..:.|.|.
Human   264 HIDEVWPSLFLGDAYAARDKSKLIQLGITHV--VNAAAGKFQVDTGAKFYRGMSLEYYGIEADDN 326

  Fly    59 PDQNLSQYFSVCNDFIHAA-RLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGR 122
            |..:||.||.....:|.|| .:.:|.||:||..|:|||.|:.:|::|...::...||::.|:|.|
Human   327 PFFDLSVYFLPVARYIRAALSVPQGRVLVHCAMGVSRSATLVLAFLMICENMTLVEAIQTVQAHR 391

  Fly   123 AVANPNAGFQSQLQEFEQFKLSEERRR 149
            .:. ||:||..|||..:. :|..|..|
Human   392 NIC-PNSGFLRQLQVLDN-RLGRETGR 416

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 45/146 (31%)
DUSP13XP_005269940.1 DSPc 264..407 CDD:238073 45/146 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.