DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10089 and Dusp13

Sequence 1:NP_001261803.1 Gene:CG10089 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:XP_008768696.1 Gene:Dusp13 RGDID:1359712 Length:342 Species:Rattus norvegicus

Alignment Length:160 Identity:48/161 (30%)
Similarity:86/161 (53%) Gaps:19/161 (12%)


  Fly     4 HMGKVLPGLYVGNYRDSKDHAQLERFKISHIIAIH------DSPRRL---LPDKHYLCVMASDTP 59
            |:.:|.|.|::|:...::|.::|.:..|:|::.:.      |:..:.   .|.::| .:.|.|.|
  Rat   189 HINEVWPNLFLGDAYAARDKSRLIQLGITHVVNVAAGKFQVDTGAKFYRGTPVEYY-GIEADDNP 252

  Fly    60 DQNLSQYF----SVCNDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRA 120
            ..:||.||    ....|.::..|.|   ||:||..|:|||.|:.:|::|...::...:|::.|:|
  Rat   253 FFDLSVYFLPVARYIRDALNTPRSR---VLVHCAMGVSRSATIVLAFLMIFENMTLVDAIQTVQA 314

  Fly   121 GRAVANPNAGFQSQLQEFEQFKLSEERRRL 150
            .|.:. ||:||..|||..:. :|..|..||
  Rat   315 HRDIC-PNSGFLRQLQVLDN-RLRRETGRL 342

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 44/148 (30%)
Dusp13XP_008768696.1 DSPc 189..332 CDD:238073 44/148 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.