DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10089 and Dusp18

Sequence 1:NP_001261803.1 Gene:CG10089 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001013146.2 Gene:Dusp18 RGDID:1306929 Length:204 Species:Rattus norvegicus

Alignment Length:140 Identity:40/141 (28%)
Similarity:71/141 (50%) Gaps:2/141 (1%)


  Fly     5 MGKVLPGLYVGNYRDSKDHAQLERFKISHIIAIH-DSPRRLLPDKHYLCVMASDTPDQNLSQYFS 68
            :.::...|::.|...:.|...|...:|:.:|.:. :.......|..|:.|...|.|...||.:|.
  Rat    20 LSQITKSLFISNGAAANDKLLLSSNQITTVINVSVEVANTFYEDIQYVQVPVVDAPIARLSDFFD 84

  Fly    69 VCNDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVANPNAGFQS 133
            ...|.||:..:::|..|:||.||:|||..:.:||:|....::..:|....::.|.:..||:||..
  Rat    85 PIADHIHSVEMKQGRTLLHCAAGVSRSAALCLAYLMKYHAMSLLDAHAWTKSRRPIIRPNSGFWE 149

  Fly   134 QLQEFEQFKL 143
            ||..:| |:|
  Rat   150 QLIHYE-FQL 158

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 37/135 (27%)
Dusp18NP_001013146.2 DSPc 19..155 CDD:238073 37/135 (27%)
Sufficient for mitochondrial localization. {ECO:0000250} 95..141 14/46 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.