DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10089 and Dusp16

Sequence 1:NP_001261803.1 Gene:CG10089 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001100094.1 Gene:Dusp16 RGDID:1310721 Length:661 Species:Rattus norvegicus

Alignment Length:472 Identity:122/473 (26%)
Similarity:186/473 (39%) Gaps:93/473 (20%)


  Fly     7 KVLPGLYVGNYRDSKDHAQLERFKISHII-AIHDSPR-RLLPDKHYLCVMASDTPDQNLSQYFSV 69
            ::||.||:|..||..:...:::..|.::: |.:..|: ..:|:.|:|.|..:|:..:.:..:...
  Rat   161 RILPNLYLGCQRDVLNKELMQQNGIGYVLNASNTCPKPDFIPESHFLRVPVNDSFCEKILPWLDK 225

  Fly    70 CNDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVANPNAGFQSQ 134
            ..|||..|:...|.||||||||:|||.|:|:||||....::..||.:.|:..|...:||..|..|
  Rat   226 SVDFIEKAKASNGCVLIHCLAGISRSATIAIAYIMKRMDMSLDEAYRFVKEKRPTISPNFNFMGQ 290

  Fly   135 LQEFE-----QFKLSEERRRLRERFPSSALEQLDRTK---VATALDNYQELLQNRDICEGNCSR- 190
            |.::|     |..:|..:.:|:       |..||:..   .|.:....:..|.....|..:.|. 
  Rat   291 LMDYEKTISSQTGMSGPKSKLK-------LLHLDKASEPVPAASEGGRKNALSLSPPCANSTSEA 348

  Fly   191 -GEKC--PTGVCNMDPTKGLFRRRP-----SNASTHSRLRAQSSNANASSS----SLSVSSAAAQ 243
             |::.  |..|.::.|:  |....|     |.....|.....|:....|.|    |:|.|::.|.
  Rat   349 VGQRLVHPASVPSLQPS--LLEDSPLVQALSGLQLSSEKLEDSNRLKRSFSLDIKSVSYSASVAA 411

  Fly   244 SCPTSPKNSPLPIVRRSV---GNERI----PEDEIVLEQPPTTSREAAEYAAAFEDARREQEQRQ 301
            |.........:...:.|.   |..::    |..| |.||.|.||              .::|:..
  Rat   412 SLHGFSSEDAMEYYKPSATLDGTSKLCQFSPVQE-VSEQTPETS--------------PDKEEAH 461

  Fly   302 LQQQQQLSRSQRSPRPVNSSREAPRVSSAGSRRESAAREGNGSAQLQRSASTVSGFGVRPRSSPA 366
            :.:|.|.:|...|..               :|..|......||.|             ||..|| 
  Rat   462 IPRQPQATRPSESQT---------------TRLHSVRTSSTGSTQ-------------RPFFSP- 497

  Fly   367 GLHAYTGSVPSSVH-----GSRVDLRDADKGSAIYLGCSAPRASTLSISSSRGS--SGGSAPPSP 424
             ||. :|||..:.|     |.....:...| ||..||.....:..|...||..|  ||......|
  Rat   498 -LHR-SGSVEDNYHTNFLFGLSTSQQHLTK-SAAGLGLKGWHSDILPPQSSAPSLTSGWYFATEP 559

  Fly   425 CHTPPASPRHGVKRSTS 441
            .|...||..:|...|.|
  Rat   560 SHFYSASAIYGGNASYS 576

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 46/134 (34%)
Dusp16NP_001100094.1 DSP_MapKP 10..136 CDD:238723
DSPc 158..295 CDD:238073 46/134 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.