DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10089 and Dusp15

Sequence 1:NP_001261803.1 Gene:CG10089 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001152848.1 Gene:Dusp15 MGIID:1934928 Length:235 Species:Mus musculus

Alignment Length:257 Identity:96/258 (37%)
Similarity:137/258 (53%) Gaps:46/258 (18%)


  Fly     5 MGKVLPGLYVGNYRDSKDHAQLERFKISHIIAIHDSPRRLLPDKHYLCVMASDTPDQNLSQYFSV 69
            |.|||||||:||:.|:||..||.|.||:|||:||:||:.||.|..||.:..||||:..:.::|..
Mouse     5 MTKVLPGLYLGNFIDAKDPDQLGRNKITHIISIHESPQPLLQDITYLRISVSDTPEVPIKKHFKE 69

  Fly    70 CNDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVANPNAGFQSQ 134
            |..|||:.||..||.|:||.||:|||.|:.:||:||.|.|.|:|.|:.::|.|.:||||.||:.|
Mouse    70 CVHFIHSCRLNGGNCLVHCFAGISRSTTIVIAYVMTVTGLGWQEVLEAIKASRPIANPNPGFRQQ 134

  Fly   135 LQEFEQFKLSEERRRLRERFPSSALEQLDRTKVATALDNYQELLQNRDICEGNCSRGEKCPTGVC 199
            |:||......:.||:|.|||........:..:....|                |.|   |..|  
Mouse   135 LEEFGWANSQKLRRQLEERFGEIPFRDEEDLRALLPL----------------CRR---CRQG-- 178

  Fly   200 NMDPTKGLFRRRPSNASTHSRLRAQSSNANASSSSLSVSSAAAQSCPTSPKNS--PLPIVRR 259
                                   :.:|.|:|:::|.:......:..|.||::|  |||::.|
Mouse   179 -----------------------SATSAASATTASSAAEGTLQRLVPRSPRDSHQPLPLLAR 217

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 73/134 (54%)
Dusp15NP_001152848.1 DSPc 4..138 CDD:238073 72/133 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1576308at2759
OrthoFinder 1 1.000 FOG0002815
OrthoInspector 1 1.000 T615484
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45948
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.880

Return to query results.
Submit another query.