DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10089 and Ssh2

Sequence 1:NP_001261803.1 Gene:CG10089 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:XP_006533290.1 Gene:Ssh2 MGIID:2679255 Length:1450 Species:Mus musculus

Alignment Length:526 Identity:104/527 (20%)
Similarity:186/527 (35%) Gaps:147/527 (28%)


  Fly     7 KVLPGLYVGNYRDSKDHAQLERFKISHIIAIHDSPRRLLP---DKHYLCVMASDTPDQNLSQYFS 68
            ::...:::|:..::.:...|:...:.:|:.:........|   :.|.:.|...:..|  |..|::
Mouse   337 QIFEHVFLGSEWNASNLEDLQNRGVRYILNVTREIDNFFPGVFEYHNIRVYDEEATD--LLAYWN 399

  Fly    69 VCNDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVANPNAGFQS 133
            ....||..|:......|:||..|:|||.:..:||.|.....|...|...|:..|.|..||..|..
Mouse   400 DTYKFISKAKKHGSKCLVHCKMGVSRSASTVIAYAMKEYGWNLDRAYDYVKERRTVTKPNPSFMR 464

  Fly   134 QLQEFEQFKLSEERR--RLRERFPSSALE-----------QLDRTKVATALDNYQEL-------- 177
            ||:|::...|:.::|  :|......|.|.           :|::.::.|:.|...|:        
Mouse   465 QLEEYQGILLASKQRHNKLWRSHSDSDLSDHHEPICKPGLELNKKEMTTSADQIAEVKTVENLAA 529

  Fly   178 --------------------LQNRDIC---------------EGNCSRGEKCPTGVC-------- 199
                                .:.|.||               |.|.:....|.:|.|        
Mouse   530 MPTVFMEHVVPQDANQKGLHTKERVICLEFSSQEFRAGQIEDELNLNDINGCSSGCCLSESKLPL 594

  Fly   200 -NMDPTKGLFR--RRPSNASTHSRLRAQSSNANASSSSLSVSSAAAQSCPTSPKNSPLPIVRRSV 261
             |...:|.|.:  :.|..|:....|..:....:|..:.::|.....:...:..|:.|:.      
Mouse   595 DNCHASKALLQPGQAPDIANKFPDLAVEDLETDALKADMNVHLLPMEELTSRLKDLPMS------ 653

  Fly   262 GNERIPEDEIVLEQP-PTTSREAA---------EYAAAFEDARREQEQRQLQQQQQLSRSQRSPR 316
                 |:    ||.| |..|.:||         ::.:|            |::..:||:..|| |
Mouse   654 -----PD----LESPSPQASCQAAISDFSTDRIDFFSA------------LEKFVELSQETRS-R 696

  Fly   317 PVNSSREAPRVSSAGSRRESAAREGNGSAQLQRSASTVSGFGVRPRSSPAGLHAYTGSVPSSVHG 381
            ..:.|    |:...|..|.    ||...:.::.:||.::....|           :.|:.::.|.
Mouse   697 SFSHS----RIEELGGGRS----EGCRLSVIEVAASEMAADDQR-----------SSSLSNTPHA 742

  Fly   382 SRVDLRDADKGSA--------IYLGCSAPRASTL--------SISSSRG--SSGGSAPPSPCHTP 428
            |.....|.|:..|        |.:...:..|.::        |||...|  ...|....:|||||
Mouse   743 SEESSVDEDQSKAITELVSPDIIMQSHSENAISVKEIVTEIESISQGVGQVQLKGDILSNPCHTP 807

  Fly   429 PASPRH 434
            ..|..|
Mouse   808 KKSTIH 813

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 33/135 (24%)
Ssh2XP_006533290.1 SSH-N 40..263 CDD:212166
DEK_C 278..329 CDD:285919
DSPc 335..470 CDD:238073 33/135 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.