DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10089 and Y54F10BM.13

Sequence 1:NP_001261803.1 Gene:CG10089 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_497538.1 Gene:Y54F10BM.13 WormBaseID:WBGene00021867 Length:227 Species:Caenorhabditis elegans

Alignment Length:141 Identity:52/142 (37%)
Similarity:74/142 (52%) Gaps:2/142 (1%)


  Fly     5 MGKVLPGLYVGNYRDSKDHAQLERFKISHIIAIHDSPRRLLPDK-HYLCVMASDTPDQNLSQYFS 68
            :|:.||.|..|:...:.|...||..||:||:.:........|.| .||.:...|.|:..:..||.
 Worm    83 VGEALPDLLFGSQDVAADLPILENRKITHIVNVGTGIPNHFPKKFEYLQIDILDLPETRIIDYFE 147

  Fly    69 VCNDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVANPNAGFQS 133
            ...:||...|..||.|.|||.||:|||.|..|||:|....::.:||:...|..|:: .||.||..
 Worm   148 RVFEFIDKVRQNEGIVFIHCNAGISRSATFVVAYLMKNLKISCREAMDKCRETRSI-RPNTGFAQ 211

  Fly   134 QLQEFEQFKLS 144
            ||:|:|...:|
 Worm   212 QLKEYEAILVS 222

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 50/135 (37%)
Y54F10BM.13NP_497538.1 DSPc 87..217 CDD:238073 49/131 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1042
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.