DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10089 and dusp5

Sequence 1:NP_001261803.1 Gene:CG10089 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_997730.1 Gene:dusp5 ZFINID:ZDB-GENE-010625-1 Length:368 Species:Danio rerio

Alignment Length:138 Identity:49/139 (35%)
Similarity:74/139 (53%) Gaps:9/139 (6%)


  Fly     7 KVLPGLYVGNYRDSKDHA-QLERFKISHIIAIHDSPRR-LLPDK---HYLCVMASDTPDQNLSQY 66
            ::||.||:|    |..|| :.:.....||.|:.:..|| ..|.:   :|..:...|:...::|.:
Zfish   174 EILPFLYLG----SAYHACRQDYLSDLHITALLNVSRRDSRPARGQYNYKWIPVEDSHTADISSH 234

  Fly    67 FSVCNDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVANPNAGF 131
            |....|||...:...|.||:||.||:|||.|:.:||||....|..::|..|:|..||:.:||..|
Zfish   235 FQEAIDFIERVKAEGGKVLVHCEAGISRSPTICMAYIMKTQRLRLEQAFDVIRQRRAIISPNFSF 299

  Fly   132 QSQLQEFE 139
            ..||.:||
Zfish   300 MGQLLQFE 307

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 48/137 (35%)
dusp5NP_997730.1 DSP_MapKP 5..135 CDD:238723
DSPc 172..307 CDD:238073 48/137 (35%)
CDC14 <193..327 CDD:225297 41/116 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.