DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10089 and ssh1

Sequence 1:NP_001261803.1 Gene:CG10089 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:XP_002932127.1 Gene:ssh1 XenbaseID:XB-GENE-6041963 Length:975 Species:Xenopus tropicalis

Alignment Length:600 Identity:111/600 (19%)
Similarity:203/600 (34%) Gaps:191/600 (32%)


  Fly    12 LYVGNYRDSKDHAQLERFKISHIIAIHDSPRRLLPDK---HYLCVMASDTPDQNLSQYFSVCNDF 73
            :|:|:..::.:..:|....:.:|:.:........|..   |.:.|...:|.|  |..:::....|
 Frog   314 VYLGSEWNASNLEELHSTGVGYILNVTREIDNFFPGMFAYHNIRVYDEETTD--LLSHWNDAYHF 376

  Fly    74 IHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVANPNAGFQSQLQEF 138
            |..|:..:...|:||..|:|||.:..:||.|.....:.::|...|:..|:|..|||||..||.|:
 Frog   377 ITKAKKNKSKCLVHCKMGVSRSASTVIAYAMKENGWSMEKAYNFVKQKRSVTRPNAGFMRQLLEY 441

  Fly   139 EQFKLSEERRRLR-------------------------------ERFPSS--------------- 157
            |....:.::|..:                               |..|.|               
 Frog   442 EGILDASKQRHNKLWMPPIFPTSYGQDTLETEFNYGLNEDYVKAETLPESYCLRHLNNPCELIEP 506

  Fly   158 -----ALEQLDR------TKVATALDN-------------YQELLQ-----------NRDICEGN 187
                 .:|:|:|      |.|.|...|             :::||.           .|.:.||:
 Frog   507 LSVELEVEELERDALLGDTDVGTIRQNSPFLEGEIRKKLDFEDLLSPKRYKDDFGPAERHMKEGD 571

  Fly   188 C--------------------SRGEKCPTGVCNMDPTKGLFRR--------------RPS----- 213
            .                    |....||... ..|...|:..:              :||     
 Frog   572 SHIPFVPDYDEQVYKENLSSNSSKRSCPKDT-EEDAIFGILSKVKPPYPSCTDCVYPKPSEEPQK 635

  Fly   214 -------NAST----HSRLRAQSSNANASSSSLSVSSAAAQSCPTSPKNSPLPIVRRSVGNERIP 267
                   |::|    .:.|:..:|..........:....|:||| ...:||..::  ::..:: |
 Frog   636 PYCEPALNSTTVCTQPTLLQHMTSAVLNRMHGDKMEEELAKSCP-GHLHSPSRVI--AITRQK-P 696

  Fly   268 EDEIVLEQPPTTSREAAEYAA----AFEDARREQEQRQL----------------QQQQQLSRSQ 312
            .|.  .|:..|.:.|...:||    :.:||::.::|:.|                |.|:.:.:.|
 Frog   697 FDS--TEKQSTVTPEVDPFAAGGLLSRKDAKQYRDQKYLFFTKELEKPTMHSYLMQHQESIIQLQ 759

  Fly   313 RSPRPVNSSREAPRVSSAGSR--RESAAREGNGSA-----QLQRSASTVSGFGVRPRSSPAGLHA 370
            ::......::|..|:.|.|:.  ::....:.|.|.     .|......|...|....:....::|
 Frog   760 KAGLVRKHTKELERLKSEGTSVGKDVCIEKTNCSGLYCTKDLPTYPELVQSNGQNNVAKTEMVNA 824

  Fly   371 YTG-----SVPSSVHGSRVDLRDADKGSAIYLGCSAPRASTLSISSSRGSSGGSAPPSPCHTPPA 430
            ..|     |.|:.....::.....|....|   |..|.:|::|.:.:|.||..|.          
 Frog   825 LDGTFQKTSTPNFCKLDQISSYTKDFLKTI---CYTPTSSSISSNLTRSSSSDSI---------- 876

  Fly   431 SPRHGVKRSTSLVKK 445
               |.|:....|||:
 Frog   877 ---HSVRGMPGLVKQ 888

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 35/130 (27%)
ssh1XP_002932127.1 SSH-N 3..235 CDD:212166
DEK_C 253..301 CDD:285919
DSPc 306..442 CDD:238073 35/130 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.