DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10089 and styx

Sequence 1:NP_001261803.1 Gene:CG10089 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001135695.1 Gene:styx XenbaseID:XB-GENE-967347 Length:223 Species:Xenopus tropicalis

Alignment Length:193 Identity:60/194 (31%)
Similarity:95/194 (49%) Gaps:21/194 (11%)


  Fly     1 MNWHMGKVLPGLYVGNYRDSKDH--AQLERFKISHIIAIHDS--PRRLLPD----KHYLCVMASD 57
            |...|.::||||::|.|..:...  :.|::..|:|:|.|..:  ...:.|:    ..||.:..:|
 Frog    25 MRREMQEILPGLFLGPYSAAMKSKLSVLQKCGITHVICIRQNIEANFIKPNFQQLFRYLVLDIAD 89

  Fly    58 TPDQNLSQYFSVCNDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGR 122
            .|.:|:.::|.:..:||.......|.||||..||:|||..:.:||||....:.:::|...|:..|
 Frog    90 NPVENIIRFFPMSKEFIDGCLQTGGKVLIHGNAGISRSAALVIAYIMETFGIKYRDAFTYVQERR 154

  Fly   123 AVANPNAGFQSQLQEFEQFKLSEERRRLRER--------FPSSALEQLDRTKVATALDNYQEL 177
            ...||||||..||||:|...|::...::...        ..|.|...|.||     ||:..||
 Frog   155 FCINPNAGFVHQLQEYEAIYLAKLTIKMMSPLQLGRPLCIQSGATGSLKRT-----LDDEDEL 212

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 48/143 (34%)
styxNP_001135695.1 DSPc 28..171 CDD:238073 48/143 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.