DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10154 and CG10140

Sequence 1:NP_001189089.1 Gene:CG10154 FlyBaseID:FBgn0036361 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_648648.2 Gene:CG10140 FlyBaseID:FBgn0036363 Length:297 Species:Drosophila melanogaster

Alignment Length:299 Identity:133/300 (44%)
Similarity:178/300 (59%) Gaps:39/300 (13%)


  Fly    38 GLNVQDKDIYDMYENT-----------------QINVCGNVADGVYLPYVGNCSKYIECENNTIK 85
            |...:|.|:....::|                 .:::||||||.|:||:||:|::|..|.:    
  Fly    18 GARPKDLDVSGTTDSTLETDSTTSGLEYGLITGNLSICGNVADNVFLPFVGDCNRYYLCRS---- 78

  Fly    86 EVGSCLDLAKDNPDICDPNKSCELGYD--PVLQVCTYMEEVQCLPTCESFRLSSFCYDNTCTKYV 148
              |..::|            .||..|:  ...|.|.:..:..||||||:|..|:|.|..|||:||
  Fly    79 --GQAIEL------------QCEWPYEFNANTQSCVHPGDADCLPTCEAFNFSTFSYQRTCTRYV 129

  Fly   149 LCYYGKPVLRQCHDGLQYNNATDRCDFPEYVDCVANDCSATFQPEDIIYLGSKASCSKYYVCSNG 213
            ||||||||||||.||||||:||||||||:.||||.::||.......:.|:.||.||.||::|.||
  Fly   130 LCYYGKPVLRQCQDGLQYNSATDRCDFPQNVDCVESECSIYSNAYHLRYVPSKVSCQKYFICGNG 194

  Fly   214 HPWEQQCAPGLAYNPSCKCCDFAKNVNCTIDAVARNILPYSR-TPLRRADIKCPLMGTHFFPHKS 277
            .|.||.|..||.::..|.|||.....:|.|.||.|.:...|| :|:....| ||..|.||:.|:|
  Fly   195 IPREQTCTAGLHFSTKCDCCDIPSKSDCQIPAVERKVQQLSRLSPVTTVGI-CPPSGVHFYVHES 258

  Fly   278 RRDAYYYCVEGRGVTLDCTPGLYYDPKVEDCRRPEFVGV 316
            |||||||||:|.|:.|||:.||:|||.|::||.|:.||:
  Fly   259 RRDAYYYCVDGHGLVLDCSAGLWYDPTVQECREPQNVGM 297

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10154NP_001189089.1 CBM_14 130..180 CDD:279884 38/50 (76%)
CBM_14 197..239 CDD:279884 20/42 (48%)
ChtBD2 263..311 CDD:214696 30/48 (63%)
CG10140NP_648648.2 CBM_14 63..106 CDD:279884 14/61 (23%)
CBM_14 111..161 CDD:279884 38/50 (76%)
CBM_14 178..222 CDD:279884 20/44 (45%)
CBM_14 246..295 CDD:279884 30/49 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C5148778
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1174178at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23301
RoundUp 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.