DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10154 and CG34324

DIOPT Version :10

Sequence 1:NP_648646.2 Gene:CG10154 / 39509 FlyBaseID:FBgn0036361 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001096972.1 Gene:CG34324 / 32302 FlyBaseID:FBgn0085353 Length:267 Species:Drosophila melanogaster


Alignment Length:118 Identity:32/118 - (27%)
Similarity:43/118 - (36%) Gaps:17/118 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 CLPTCESFRLSSFCYDNTCTKYVLCYYGKPVLRQCHDGLQYNNATDRCDFPEYVDCV---ANDCS 187
            |.|.|.:   :..|....||.......| |::    ||   |......|.|..:..|   .:||.
  Fly   157 CTPPCTT---TKPCTTTVCTTPKSDNAG-PIV----DG---NEEQPDIDNPVAIAQVLISRHDCR 210

  Fly   188 ATFQPEDIIYLGSKASCSKYYVCSNGHPWEQQCAPGLAYNPSCKCCDFAKNVN 240
            .   .||..:|.....|.:||||:......|.|..|..::...|.|..|..||
  Fly   211 G---QEDGTFLADVRHCRRYYVCNRQRSKRQNCPNGYWFDRELKACRLASTVN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10154NP_648646.2 CBM_14 130..181 CDD:426342 11/50 (22%)
CBM_14 197..239 CDD:426342 12/41 (29%)
ChtBD2 263..311 CDD:214696
CG34324NP_001096972.1 CBM_14 209..262 CDD:426342 17/55 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.