DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10222 and GPN2

DIOPT Version :9

Sequence 1:NP_648641.2 Gene:CG10222 / 39504 FlyBaseID:FBgn0036356 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_060536.3 Gene:GPN2 / 54707 HGNCID:25513 Length:310 Species:Homo sapiens


Alignment Length:287 Identity:147/287 - (51%)
Similarity:201/287 - (70%) Gaps:10/287 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PTQATVENPRYGQLIIGPPGSGKTTYCGEALKFYRELGRQVGVVNLDPANENMSYEPVLSVMELI 70
            ||.|      :||.:||||||||||||....:|.|.|||:|.|||||||||.:.||..:.|.||:
Human     6 PTTA------FGQAVIGPPGSGKTTYCLGMSEFLRALGRRVAVVNLDPANEGLPYECAVDVGELV 64

  Fly    71 TVEDCMEHLKLGPNGALMHCAEYLADHLEDWLLPALRKLSATYNYFLFDCPGQVELYTHHNAMAR 135
            .:.|.|:.|:|||||.|::|.|||..:| |||...|..|..  :||||||||||||.|||.|:..
Human    65 GLGDVMDALRLGPNGGLLYCMEYLEANL-DWLRAKLDPLRG--HYFLFDCPGQVELCTHHGALRS 126

  Fly   136 IFERLERERYSLVTVNLIDSHYCSEPAKFIATLLMALNTMLRMSLPHVNVLSKADLLKKHETKLH 200
            ||.::.:....|..|:|:|||||::|||||:.|..:|.|||.:.|||:|:|||.||: :|..||.
Human   127 IFSQMAQWDLRLTAVHLVDSHYCTDPAKFISVLCTSLATMLHVELPHINLLSKMDLI-EHYGKLA 190

  Fly   201 FNVDYYTDVLDLKYLLDKLDDDPAMRKYRKLNAAICSMVEDYALVSFQLLDVFSTDSMLRLRNHI 265
            ||:||||:||||.||||.|..||..|.||:||..:..::|||:||||..|::...:|:.|:...:
Human   191 FNLDYYTEVLDLSYLLDHLASDPFFRHYRQLNEKLVQLIEDYSLVSFIPLNIQDKESIQRVLQAV 255

  Fly   266 DKANGYVYKAGEEQTVNSLLACAVGAE 292
            ||||||.::|.|::::.::::.|:||:
Human   256 DKANGYCFRAQEQRSLEAMMSAAMGAD 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10222NP_648641.2 GPN2 16..267 CDD:349780 133/250 (53%)
GPN2NP_060536.3 GPN2 10..257 CDD:349780 133/250 (53%)
Gly-Pro-Asn (GPN)-loop, involved in dimer interface. /evidence=ECO:0000250|UniProtKB:Q9UYR9 76..78 1/1 (100%)


Information from Original Tools:


Software error:

Can't use an undefined value as an ARRAY reference at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 1034.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - -
Domainoid 1 1.000 - -
eggNOG 1 0.900 - -
Hieranoid 1 1.000 - -