DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10222 and GPN2

DIOPT Version :8

Sequence 1:NP_001287060.1 Gene:CG10222 / 39504 FlyBaseID:FBgn0036356 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_060536.3 Gene:GPN2 / 54707 HGNCID:25513 Length:310 Species:Homo sapiens

Alignment Length:287 Identity:147/288 (51%)
Similarity:201/288 (70%) Gaps:10/288 (3%)


  Fly     6 PTQATVENPRYGQLIIGPPGSGKTTYCGEALKFYRELGRQVGVVNLDPANENMSYEPVLSVMELI 70
            ||.|      :||.:||||||||||||....:|.|.|||:|.|||||||||.:.||..:.|.||:
Human     6 PTTA------FGQAVIGPPGSGKTTYCLGMSEFLRALGRRVAVVNLDPANEGLPYECAVDVGELV 64

  Fly    71 TVEDCMEHLKLGPNGALMHCAEYLADHLEDWLLPALRKLSATYNYFLFDCPGQVELYTHHNAMAR 135
            .:.|.|:.|:|||||.|::|.|||..:| |||...|..|..  :||||||||||||.|||.|:..
Human    65 GLGDVMDALRLGPNGGLLYCMEYLEANL-DWLRAKLDPLRG--HYFLFDCPGQVELCTHHGALRS 126

  Fly   136 IFERLERERYSLVTVNLIDSHYCSEPAKFIATLLMALNTMLRMSLPHVNVLSKADLLKKHETKLH 200
            ||.::.:....|..|:|:|||||::|||||:.|..:|.|||.:.|||:|:|||.||: :|..||.
Human   127 IFSQMAQWDLRLTAVHLVDSHYCTDPAKFISVLCTSLATMLHVELPHINLLSKMDLI-EHYGKLA 190

  Fly   201 FNVDYYTDVLDLKYLLDKLDDDPAMRKYRKLNAAICSMVEDYALVSFQLLDVFSTDSMLRLRNHI 265
            ||:||||:||||.||||.|..||..|.||:||..:..::|||:||||..|::...:|:.|:...:
Human   191 FNLDYYTEVLDLSYLLDHLASDPFFRHYRQLNEKLVQLIEDYSLVSFIPLNIQDKESIQRVLQAV 255

  Fly   266 DKANGYVYKAGEEQTVNSLLACAVGAE 292
            ||||||.::|.|::::.::::.|:||:
Human   256 DKANGYCFRAQEQRSLEAMMSAAMGAD 282

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10222NP_001287060.1 Gem1 19..193 CDD:224025 96/174 (55%)
ATP_bind_1 20..271 CDD:281079 136/251 (54%)
GPN2NP_060536.3 Gem1 13..182 CDD:224025 95/172 (55%)
ATP_bind_1 14..261 CDD:281079 136/251 (54%)
Gly-Pro-Asn (GPN)-loop, involved in dimer interface. {ECO:0000250|UniProtKB:Q9UYR9} 76..78 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C8186103
eggNOG 1 0.900 E2759_KOG1533
Hieranoid 1 1.000
Homologene 1 1.000 H7006
Inparanoid 1 1.050 290 1.000 Inparanoid score I2772
Isobase 1 0.950 0 Normalized mean entropy S760
OMA 1 1.010
OrthoDB 1 1.010 D432496at33208
OrthoFinder 1 1.000 FOG0004454
OrthoInspector 1 1.000 T1074888
orthoMCL 1 0.900 OOG5_128188
Panther 1 1.100 LDO PTHR21231
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R520
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1514.750

Return to query results.
Submit another query.