DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10222 and SPAC144.07c

DIOPT Version :8

Sequence 1:NP_001287060.1 Gene:CG10222 / 39504 FlyBaseID:FBgn0036356 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_594668.1 Gene:SPAC144.07c / 2542899 PomBaseID:SPAC144.07c Length:315 Species:Schizosaccharomyces pombe

Alignment Length:272 Identity:117/273 (43%)
Similarity:180/273 (66%) Gaps:9/273 (3%)


  Fly    18 QLIIGPPGSGKTTYCGEALKFYRELGRQVGVVNLDPANENMSYEPVLSVMELITVEDCMEHLKLG 82
            |:::|||||||:|||....:....:||...:|||||||:.:.|...:.:.:::.||...:...||
pombe     5 QVVVGPPGSGKSTYCFGMYQLLSAIGRSSIIVNLDPANDFIKYPCAIDIRKVLDVEMIQKDYDLG 69

  Fly    83 PNGALMHCAEYLADHLEDWLLPALRKLSATYNYFLFDCPGQVELYTHHNAMARIFERLERE-RYS 146
            |||||::..|.:..|:| |||..|:|  ...:|.:|||||||||:|:||::.:|.:.||:| .|.
pombe    70 PNGALIYAMEAIEYHVE-WLLKELKK--HRDSYVIFDCPGQVELFTNHNSLQKIIKTLEKELDYR 131

  Fly   147 LVTVNLIDSHYCSEPAKFIATLLMALNTMLRMSLPHVNVLSKADLLKKHETKLHFNVDYYTDVLD 211
            .|:|.|:|::.|:.|:.:::.||:.|..||::.:||||:|||||||..:.| |...:|::|:|.|
pombe   132 PVSVQLVDAYCCTNPSAYVSALLVCLKGMLQLDMPHVNILSKADLLCTYGT-LPMKLDFFTEVQD 195

  Fly   212 LKYLLDKLDDDPAMRKYRKLNAAICSMVEDYALVSFQLLDVFSTDSMLRLRNHIDKANGYVYKA- 275
            |.||...||.|..:::|..||.|||.:|||:.||||:::.|.:..||||:...||:|.||.|.: 
pombe   196 LSYLAPLLDRDKRLQRYSDLNKAICELVEDFNLVSFEVVAVENKASMLRVLRKIDQAGGYAYGST 260

  Fly   276 ---GEEQTVNSL 284
               |:...||::
pombe   261 EIGGDAVWVNAV 272

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10222NP_001287060.1 Gem1 19..193 CDD:224025 77/175 (44%)
ATP_bind_1 20..271 CDD:281079 111/252 (44%)
SPAC144.07cNP_594668.1 Gem1 3..178 CDD:224025 78/176 (44%)
ATP_bind_1 7..255 CDD:281079 111/252 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H7006
Inparanoid 1 1.050 224 1.000 Inparanoid score I875
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004454
OrthoInspector 1 1.000 T1125672
orthoMCL 1 0.900 OOG5_128188
Panther 1 1.100 LDO PTHR21231
Phylome 1 0.910 0.986 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R520
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.