DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LDLR and mgl

Sequence 1:NP_000518.1 Gene:LDLR HGNCID:6547 Length:860 Species:Homo sapiens
Sequence 2:NP_001096924.2 Gene:mgl FlyBaseID:FBgn0261260 Length:4769 Species:Drosophila melanogaster

Alignment Length:858 Identity:285/859 (33%)
Similarity:399/859 (46%) Gaps:185/859 (22%)


Human    27 CERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETCLSVTCKSGDFSCGGRVNRCIPQFWRCDG 91
            ||.::|.|::|:|||..|.|||..:|.|.|||....|...:|...:|.|..  .|||.:.|:||.
  Fly  2826 CEASKFYCKNGRCISRMWSCDGDDDCGDNSDEDPNYCAYHSCSPNEFRCNN--GRCIFKSWKCDH 2888

Human    92 QVDCDNGSDEQGCPPKTCSQDEFRCHDGKCISR-------------------------------- 124
            :.||.:||||.||....|...||.|.:|:||.:                                
  Fly  2889 ENDCKDGSDELGCVYPPCVDGEFTCANGRCIPQAQVCNGVNDCKDNATSDETHERCPMNTTCPAN 2953

Human   125 -------------QFVCDSDRDCLDGSDE--ASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCE 174
                         .::||.|.||.|.|||  ..|...||...||:|.:..|||..|.||.|.||.
  Fly  2954 HLKCEKTNICVEPYWLCDGDNDCGDNSDEDPLHCGQRTCPTNSFRCPNHRCIPATWYCDGDDDCG 3018

Human   175 DGSDEWPQRCRG--------------------LYVFQGDSS-----------PCS------AFEF 202
            ||:||.|..|:.                    :|:..||:.           .|:      ..||
  Fly  3019 DGADEPPDYCKSEGRTCFGDLFTCDNGNCIPRIYICDGDNDCLDNSDEDNRHQCNDRKCDEETEF 3083

Human   203 HCLS------GECIHSSWRCDGGPDCKDKSDE----ENCAV------------------------ 233
            .|:.      .:||...|.|||.|||.|.:||    .|||.                        
  Fly  3084 TCVENKSWQRAQCIPKKWICDGDPDCVDGADENTTLHNCATQQPCGEDMFTCGNGRCINKGWICD 3148

Human   234 -------------------ATCRPDEFQCSDGNCIHGSRQCDREYDCKDMSDEVGCV--NVTLCE 277
                               .||...||.|.:..||....:||.|.||.|.||||||.  |:|..:
  Fly  3149 HDNDCGDGTDEGKFCNSKYKTCSAQEFTCQNFKCIRNQSRCDGEDDCGDHSDEVGCAKENITCPQ 3213

Human   278 GPNKFKCHSGECITLDKVCNMARDCRDWSDEPIKECGTNEC--LDNNGGCSHVCNDLKIGYECLC 340
            |  :|.|.:|:||..:.|||...||.|.|||| ..|..:||  ::.| .|.|.|.|...||.|.|
  Fly  3214 G--QFACTNGQCIDYNLVCNKYPDCADESDEP-AHCNVDECAKVEIN-QCGHKCVDTLTGYYCDC 3274

Human   341 PDGFQLVAQ-RRCEDIDEC-QDPDTCSQLCVNLEGGYKCQCEEGF---QLDPHTKACKAVGSI-A 399
            .:|::|:|. :.|.|:||| :.|..|||.|.|..||:.|:|:|.:   |.|.||  ||....| .
  Fly  3275 NEGYKLLADGKACADVDECLEQPGACSQHCSNTPGGFYCKCDETYYERQNDEHT--CKRKDKIPP 3337

Human   400 YLFFTNRHEVRKMTLDRSEYTSLIPNLRNVVALDTEVASNRIYWSDLSQRMICSTQLDRAHG--V 462
            :|.|||::.||.|::|..:|..:..:|.||||||.::....:|:.|::.:.|...:...|..  .
  Fly  3338 WLIFTNKYYVRNMSVDGHQYNLMHQDLMNVVALDFDIREEYMYFCDVTAKTIFRAKYGEADDEMP 3402

Human   463 SSYDTVISRDIQAPDGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRAIVVDPV 527
            ...:.||..|....:|:|:||:...:||.|.....:.|::..|.||||| |.....||||||.|.
  Fly  3403 PEREAVIRHDSHGLEGIAIDWVGRKLYWLDRHSKNLDVSELDGSKRKTL-RSGVVDPRAIVVHPG 3466

Human   528 HGFMYWTDWGTPAKIKKGGLNGVDIYSLVTEN--IQWPNGITLDLLSGRLYWVDSKLHSISSIDV 590
            .|::|:|.|...|.|.|.|::|.:...::..|  |.|||.:::|..:.|:||.|:.|..|:..|:
  Fly  3467 IGYLYFTSWHLQAYIAKMGMDGSNFSRILNWNDGIAWPNALSIDYFTDRIYWADAHLDYIAYADL 3531

Human   591 NGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSPEDMVLF 655
            .|.:|.|:|...| :.|.|:|::|:|.::|:|...:||..||:..|::..:|......|.|:.:.
  Fly  3532 EGRHRHTVLSGSK-VPHVFALSLFDDYIYWSDWNLKAIVRANKFHGANYTVLRNTTHRPYDLHIN 3595

Human   656 HNL-----TQPRGVNWCERTTLSNGGCQYLCLPAP-----------QINPHSPKFTCACPDGMLL 704
            |.|     |.|.|.|        ||||.:|||.||           .|...:|.|.||||:...|
  Fly  3596 HPLRQLPYTNPCGTN--------NGGCSHLCLIAPPPESTYLNIEGYIEEGAPIFKCACPNQFYL 3652

Human   705 ARDMRSCLTEAEA 717
            ||||::|:....|
  Fly  3653 ARDMKTCVANCTA 3665

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LDLRNP_000518.1 Ldl_recept_a 25..58 CDD:278486 16/31 (52%)
Ldl_recept_a 66..104 CDD:278486 16/38 (42%)
Ldl_recept_a 107..143 CDD:278486 16/83 (19%)
Ldl_recept_a 147..179 CDD:278486 17/32 (53%)
Ldl_recept_a 195..231 CDD:278486 17/63 (27%)
Ldl_recept_a 235..270 CDD:278486 18/35 (51%)
LDLa 278..308 CDD:294076 14/30 (47%)
FXa_inhibition 318..>346 CDD:291342 11/30 (37%)
EGF_CA 354..388 CDD:214542 17/38 (45%)
LDL-receptor class B 1 397..438 17/42 (40%)
LY 419..457 CDD:214531 11/38 (29%)
LDL-receptor class B 2 439..485 11/48 (23%)
Ldl_recept_b 439..482 CDD:278487 9/45 (20%)
LDL-receptor class B 3 486..528 18/42 (43%)
Ldl_recept_b 487..525 CDD:278487 17/38 (45%)
LDL-receptor class B 4 529..572 15/45 (33%)
Ldl_recept_b 529..569 CDD:278487 14/42 (33%)
LY 553..595 CDD:214531 14/44 (32%)
LDL-receptor class B 5 573..615 16/42 (38%)
LDL-receptor class B 6 616..658 12/42 (29%)
Ldl_recept_b 616..655 CDD:278487 11/39 (28%)
FXa_inhibition 671..711 CDD:291342 21/51 (41%)
Clustered O-linked oligosaccharides 721..768
Required for MYLIP-triggered down-regulation of LDLR. {ECO:0000269|PubMed:19520913} 811..860
NPXY motif. {ECO:0000269|PubMed:22509010} 823..828
mglNP_001096924.2 LDLa 157..189 CDD:238060
LDLa 204..236 CDD:238060
LDLa 292..327 CDD:238060
LDLa 332..366 CDD:238060
LDLa 371..412 CDD:238060
vWFA <447..488 CDD:294047
NHL 573..>716 CDD:302697
NHL repeat 573..610 CDD:271320
NHL repeat 616..654 CDD:271320
NHL repeat 657..693 CDD:271320
FXa_inhibition 763..805 CDD:291342
LY 922..964 CDD:214531
LY 973..1007 CDD:214531
Ldl_recept_a 1188..1223 CDD:278486
LDLa 1227..1259 CDD:197566
LDLa 1268..1303 CDD:238060
LDLa 1308..1343 CDD:238060
LDLa 1356..1387 CDD:238060
LDLa 1391..1423 CDD:197566
LDLa 1435..1469 CDD:197566
FXa_inhibition 1478..1513 CDD:291342
FXa_inhibition 1522..1553 CDD:291342
LY 1625..1665 CDD:214531
LY 1667..1711 CDD:214531
Ldl_recept_b 1690..1728 CDD:278487
LY 1712..1754 CDD:214531
LY 1986..2037 CDD:214531
FXa_inhibition 2151..>2179 CDD:291342
LY 2259..2305 CDD:214531
Ldl_recept_b 2326..2366 CDD:278487
LY 2352..2392 CDD:214531
NHL 2579..>2711 CDD:302697
NHL repeat 2593..2622 CDD:271320
NHL repeat 2634..2678 CDD:271320
LY 2671..2713 CDD:214531
LDLa 2867..2901 CDD:238060 16/36 (44%)
LDLa 2906..2941 CDD:238060 7/35 (20%)
LDLa 2950..2983 CDD:238060 9/33 (27%)
LDLa 3034..3066 CDD:197566 3/32 (9%)
LDLa 3080..3115 CDD:197566 14/35 (40%)
LDLa 3128..3159 CDD:238060 0/31 (0%)
LDLa 3170..3204 CDD:238060 17/34 (50%)
LDLa 3210..3242 CDD:197566 15/34 (44%)
cEGF 3269..3292 CDD:289433 10/23 (43%)
vWFA <3284..3324 CDD:294047 17/40 (43%)
LY 3362..3394 CDD:214531 10/32 (31%)
LY 3406..3448 CDD:214531 13/42 (31%)
LY 3498..3536 CDD:214531 14/38 (37%)
LY 3536..3578 CDD:214531 16/43 (37%)
FXa_inhibition 3607..3659 CDD:291342 23/60 (38%)
LDLa 3663..3696 CDD:238060 1/4 (25%)
LDLa 3705..3739 CDD:238060
LDLa 3743..3775 CDD:197566
LDLa 3784..3817 CDD:197566
LDLa 3827..3861 CDD:197566
LDLa 3871..3901 CDD:197566
LDLa 3913..3947 CDD:238060
LDLa 3952..3986 CDD:238060
LDLa 3996..4027 CDD:197566
LDLa 4043..4071 CDD:238060
LDLa 4086..4117 CDD:238060
EGF_CA 4163..4194 CDD:214542
NHL 4276..>4426 CDD:302697
NHL repeat 4291..4336 CDD:271320
Ldl_recept_b 4350..4390 CDD:278487
NHL repeat 4376..4422 CDD:271320
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.