DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LDLR and ImpE1

Sequence 1:NP_000518.1 Gene:LDLR HGNCID:6547 Length:860 Species:Homo sapiens
Sequence 2:NP_001261577.1 Gene:ImpE1 FlyBaseID:FBgn0001253 Length:1616 Species:Drosophila melanogaster

Alignment Length:260 Identity:86/261 (33%)
Similarity:119/261 (46%) Gaps:37/261 (14%)


Human     5 GWKLRWTVALLLAAAGTAVGDRCERNEFQCQ--DGKCI-SYKWVCDGSAECQDGSDESQETCLSV 66
            |.:||..|.|.|.|  .::|..|. ::.|||  |...: :.:.|||    |..|.:.||.:....
  Fly  1345 GTELRKRVDLGLEA--VSLGLACS-SDRQCQLADPHTVCNRRGVCD----CAAGEEGSQCSAERT 1402

Human    67 TCKSGDFSCGGRVNRCIPQFWRCDGQVDCDNGSDEQGCP-----PKTCSQDEFRC-HDGKCISRQ 125
            .|..|.|.|... ..||..|:.|||:.||::.|||: |.     .:||..:.||| ..|:||||.
  Fly  1403 GCSPGTFQCRSS-GVCISWFFVCDGRADCNDASDEE-CTHNARLNQTCPTESFRCQRSGRCISRA 1465

Human   126 FVCDSDRDCLDGSDEASCPVL-----TCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQRC- 184
            .:||..|.|..|.||..|...     .|...:|:|.|..|:|:...|:....|:|||||.|..| 
  Fly  1466 ALCDGRRQCPHGEDELGCDGSVKGGNACPEHTFRCGSGECLPEYEYCNAIVSCKDGSDEPPHLCG 1530

Human   185 -RGL-----------YVFQGDSSPCSAFEFH-CLSGECIHSSWRCDGGPDCKDKSDEENCAVATC 236
             |.|           .:..|......|:..| |.:|.|..::..|.|...|.|.:||:.|:|..|
  Fly  1531 SRALPNLFMRLIEAGGLLGGGRREADAYCPHRCSNGLCRSTAIVCSGRDGCGDGTDEQTCSVCRC 1595

Human   237  236
              Fly  1596  1595

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LDLRNP_000518.1 Ldl_recept_a 25..58 CDD:278486 10/36 (28%)
Ldl_recept_a 66..104 CDD:278486 15/38 (39%)
Ldl_recept_a 107..143 CDD:278486 17/37 (46%)
Ldl_recept_a 147..179 CDD:278486 12/32 (38%)
Ldl_recept_a 195..231 CDD:278486 11/37 (30%)
Ldl_recept_a 235..270 CDD:278486 1/3 (33%)
LDLa 278..308 CDD:294076
FXa_inhibition 318..>346 CDD:291342
EGF_CA 354..388 CDD:214542
LDL-receptor class B 1 397..438
LY 419..457 CDD:214531
LDL-receptor class B 2 439..485
Ldl_recept_b 439..482 CDD:278487
LDL-receptor class B 3 486..528
Ldl_recept_b 487..525 CDD:278487
LDL-receptor class B 4 529..572
Ldl_recept_b 529..569 CDD:278487
LY 553..595 CDD:214531
LDL-receptor class B 5 573..615
LDL-receptor class B 6 616..658
Ldl_recept_b 616..655 CDD:278487
FXa_inhibition 671..711 CDD:291342
Clustered O-linked oligosaccharides 721..768
Required for MYLIP-triggered down-regulation of LDLR. {ECO:0000269|PubMed:19520913} 811..860
NPXY motif. {ECO:0000269|PubMed:22509010} 823..828
ImpE1NP_001261577.1 EB 75..131 CDD:279949
LDLa 1404..1437 CDD:238060 15/34 (44%)
LDLa 1448..1483 CDD:238060 16/35 (46%)
LDLa 1493..1524 CDD:238060 12/31 (39%)
LDLa 1561..1590 CDD:238060 10/29 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.