DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LDLR and arr

Sequence 1:NP_000518.1 Gene:LDLR HGNCID:6547 Length:860 Species:Homo sapiens
Sequence 2:NP_524737.2 Gene:arr FlyBaseID:FBgn0000119 Length:1678 Species:Drosophila melanogaster

Alignment Length:458 Identity:136/459 (30%)
Similarity:219/459 (48%) Gaps:83/459 (18%)


Human   288 ECITLDKVCNMARDCRDWSDEPIKECGTNECLDNNGGCSHVC----NDLKIGYECLCPDGFQLVA 348
            |.|...|..|   ..|.| |..::....|.|..|||.|||:|    |..  |:.|.||.|.:|::
  Fly   335 ELIDTPKAPN---SVRAW-DPSLQPYEDNPCAHNNGNCSHLCLLATNSQ--GFSCACPTGVKLIS 393

Human   349 QRRCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACKAVGSIAYLFFTNRHEVRKMT 413
            ...|                                         |.||...:|...|.::.|::
  Fly   394 ANTC-----------------------------------------ANGSQEMMFIVQRTQISKIS 417

Human   414 LDRSEYTSLIP----NLRNVVALDTEVASNRIYWSDLSQRMICSTQLDRAH----GVSSYDTVIS 470
            ||..:|| :.|    .::..:|:|.:.....|||||:.     :..:.|||    ||:.:   ::
  Fly   418 LDSPDYT-IFPLPLGKVKYAIAIDYDPVEEHIYWSDVE-----TYTIKRAHADGTGVTDF---VT 473

Human   471 RDIQAPDGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRAIVVDPVHGFMYWTD 535
            .:::.|||||:||:..|:||||:|...:.|....|..||.|..|:..:||||.|.|..|:|:|:|
  Fly   474 SEVRHPDGLALDWLARNLYWTDTVTDRIEVCRLDGTARKVLIYEHLEEPRAIAVAPSLGWMFWSD 538

Human   536 WG-TPAKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRKTIL 599
            |. ...|:::..|:|.:...||:||:.|||||.||:.:..:||.|.|...|...:::|..|:.::
  Fly   539 WNERKPKVERASLDGSERVVLVSENLGWPNGIALDIEAKAIYWCDGKTDKIEVANMDGSGRRVVI 603

Human   600 EDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSPEDMVL-FHNLTQPRG 663
            .|  .|.|.|.|::.:|.::|||....:|..|:::||::..::.:..  |:.|.| ...|.:.||
  Fly   604 SD--NLKHLFGLSILDDYLYWTDWQRRSIDRAHKITGNNRIVVVDQY--PDLMGLKVTRLREVRG 664

Human   664 VNWCERTTLSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLARDMRSCLTEAEAAVATQETSTVR 728
            .|.|   .:.||||.:|||..|:      .:.|.|.....||.|.|:|:..|...:.:::....|
  Fly   665 QNAC---AVRNGGCSHLCLNRPR------DYVCRCAIDYELANDKRTCVVPAAFLLFSRQEHIGR 720

Human   729 LKV 731
            :.:
  Fly   721 ISI 723

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LDLRNP_000518.1 Ldl_recept_a 25..58 CDD:278486
Ldl_recept_a 66..104 CDD:278486
Ldl_recept_a 107..143 CDD:278486
Ldl_recept_a 147..179 CDD:278486
Ldl_recept_a 195..231 CDD:278486
Ldl_recept_a 235..270 CDD:278486
LDLa 278..308 CDD:294076 7/20 (35%)
FXa_inhibition 318..>346 CDD:291342 14/32 (44%)
EGF_CA 354..388 CDD:214542 0/34 (0%)
LDL-receptor class B 1 397..438 11/45 (24%)
LY 419..457 CDD:214531 10/42 (24%)
LDL-receptor class B 2 439..485 17/50 (34%)
Ldl_recept_b 439..482 CDD:278487 15/47 (32%)
LDL-receptor class B 3 486..528 18/42 (43%)
Ldl_recept_b 487..525 CDD:278487 17/38 (45%)
LDL-receptor class B 4 529..572 19/44 (43%)
Ldl_recept_b 529..569 CDD:278487 18/41 (44%)
LY 553..595 CDD:214531 17/42 (40%)
LDL-receptor class B 5 573..615 12/42 (29%)
LDL-receptor class B 6 616..658 11/43 (26%)
Ldl_recept_b 616..655 CDD:278487 11/40 (28%)
FXa_inhibition 671..711 CDD:291342 14/40 (35%)
Clustered O-linked oligosaccharides 721..768 1/12 (8%)
Required for MYLIP-triggered down-regulation of LDLR. {ECO:0000269|PubMed:19520913} 811..860
NPXY motif. {ECO:0000269|PubMed:22509010} 823..828
arrNP_524737.2 LY 162..201 CDD:214531
NHL 168..503 CDD:302697 60/224 (27%)
NHL repeat 172..237 CDD:271320
LY 252..293 CDD:214531
NHL repeat 261..298 CDD:271320
NHL repeat 303..339 CDD:271320 2/4 (50%)
NHL repeat 341..419 CDD:271320 29/125 (23%)
NHL repeat 428..476 CDD:271320 12/56 (21%)
LY 472..511 CDD:214531 15/39 (38%)
NHL repeat 477..503 CDD:271320 13/26 (50%)
Ldl_recept_b 534..573 CDD:278487 17/39 (44%)
LY 558..599 CDD:214531 17/41 (41%)
LY 600..641 CDD:214531 13/43 (30%)
FXa_inhibition 668..703 CDD:291342 15/44 (34%)
LY 739..773 CDD:214531
LY 776..818 CDD:214531
LY 819..860 CDD:214531
FXa_inhibition 973..1010 CDD:291342
LY 1122..1164 CDD:214531
FXa_inhibition 1273..1313 CDD:291342
LDLa 1319..1362 CDD:238060
LDLa 1365..1399 CDD:238060
LDLa 1399..1433 CDD:197566
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.