DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LDLR and LpR2

Sequence 1:NP_000518.1 Gene:LDLR HGNCID:6547 Length:860 Species:Homo sapiens
Sequence 2:NP_001097928.1 Gene:LpR2 FlyBaseID:FBgn0051092 Length:1064 Species:Drosophila melanogaster

Alignment Length:849 Identity:336/850 (40%)
Similarity:468/850 (55%) Gaps:68/850 (8%)


Human    27 CERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETCLSVTCKSGDFSCGGRVNRCIPQFWRCDG 91
            |.:.:|:|.:||||..:||||...:|.||||||...|.|.||...:|:|......|||..|.||.
  Fly   236 CSQEQFRCGNGKCIPRRWVCDRENDCADGSDE
STSQCRSHTCSPEEFACKSGEGECIPLSWMCDQ 300

Human    92 QVDCDNGSDEQGCPPKTCSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEASC-PVLTCGPASFQC 155
            ..||.:||||..| .:||..|||.|.:|:||..:|.||.|.||.|||||.:| ....||...|.|
  Fly   301 NKDCRDGSDEAQC
-NRTCRSDEFTCGNGRCIQNRFKCDDDDDCGDGSDEKNCGEKAKCGSNFFAC 364

Human   156 NSSTCIPQLWACDNDPDCEDGSDEWPQRCR-GLYVFQGDSSPCSAFEFHCLSG-ECIHSSWRCDG 218
            .|..|||..|.||.|.||.:|.||. |.|. .|..|      |.|.||.|... .|:|.||.|||
  Fly   365 KSGPCIPNQWVCDGDSDCRNGEDE
M-QNCTVSLLNF------CQAGEFQCSDRITCLHKSWVCDG 422

Human   219 GPDCKDKSDE--ENCAVATCRPDEFQCSDGNCIHGSRQCDREYDCKDMSDEVGC-VNVT--LCEG 278
            ..||.|..||  .||...:||||:|||:|.:||.|...|:.:.||.|.|||:.| ::.|  .|..
  Fly   423 EADCPDGEDE
SQSNCLKVSCRPDQFQCNDQSCIAGHLTCNGKRDCADGSDEIMCDISATPRTCNA 487

Human   279 PNKFKCHSGECITLDKVCNMARDCRDWSDEPIKECGTNECLDNNGGCSHVCNDLKIGYECLCPDG 343
            ..:|.|..|.||...||||..:||.:..|||..:||.|||...||||.|.|.:|::||.|.|.||
  Fly   488 TTEFDCGGGLCIPNAKVCNRRKDCPNGEDE
PAGKCGINECSSKNGGCMHQCVNLEVGYRCECHDG 552

Human   344 FQLVA-QRRCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQ--LDPHTKACKAVGSIAYLFFTN 405
            ::|.| |..|.|||||:.|..|||:|||..|.:||:||.|:.  |..||: |||....|.|....
  Fly   553 YKLGADQHTC
VDIDECETPGICSQVCVNEIGAFKCECEAGYMRLLKNHTR-CKASEGHASLLLAR 616

Human   406 RHEVRKMTLDRSEYTSLIPNLRNVVALDTEVASNRIYWSDLSQRMICSTQLDRAHGVSSYDTVIS 470
            ||::||:.|||.|.||::.:.:...|||....:..|:|||::.:.|....:|..   :....|::
  Fly   617 RHDIRKIALDRPEMTSIVNSTKAATALDFVFRTGMIFWSDVATQSIYKAPIDEG---NDRTVVLT 678

Human   471 RDIQAPDGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRAIVVDPVHGFMYWTD 535
            :.....||||||||::::|:||:...|:.:.:.:|...|.|.:::...||:|.:||:.|:|||:|
  Fly   679 KSSVTSDGLAVDWIYNHVYFTDTHKCTIELTNFEGSMGKVLVKDSLDIPRSIALDPIEGWMYWSD 743

Human   536 WGTPAKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRKTILE 600
            ||...:|::.|::|....:::|.:::|||||||||:..||||||.||::|||.:.:|..|..:|.
  Fly   744 WGASPRIERAGMDGTHRTAIITYDVKWPNGITLDLVQKRLYWVDGKLNTISSSNYDGSQRHQVLY 808

Human   601 DEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSPEDMV--LFHNLTQPRG 663
            ..:.|.||||:..|||.|:|||...:|:|.||:..|.||..:....:....||  ::|...||.|
  Fly   809 SGEYLRHPFSITTFEDYVYWTDWDKQAVFKANKFNGMDVEPVTATHMLEHPMVVHVYHPYRQPDG 873

Human   664 VNWCERTTLSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLARDMRSCLTE-----------AEA 717
            ||.|:..   ||.|.:||||||:||..||:.:||||.|:.|..|...|:.:           ...
  Fly   874 VNHCQSV---NGHCSHLCLPAPRINERSPRISCACPTGLKLMPDGLMCVEDLGIPTVRPTAPMHR 935

Human   718 AVATQETSTVRLK---VSSTAVRTQHTTTRPVPDTSRLPGATPGLTTVEIVTMSHQALGDVAGRG 779
            .:.....||.:|.   .|.|.|.|:....|  .|||.....:...:..:.|.::...:..:||  
  Fly   936 TIEQSSNSTTKLPQDGYSETPVETKTGNNR--TDTSNQVHKSDAESENDYVEIALHVIASLAG-- 996

Human   780 NEKKPSSVRALSIVLPIVLLVF-LCLGVFLLWKNWRLKNINSINFDNPVYQKTTEDEVHICHNQD 843
                      .::|..::.:|: .|           .:.:||:||:||||.|||||...:..|..
  Fly   997 ----------TALVASVIYVVYRRC-----------TRAVNSMNFENPVYHKTTEDHFSLEKNGT 1040

Human   844 GYSY 847
            .:.|
  Fly  1041 PHIY 1044

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LDLRNP_000518.1 Ldl_recept_a 25..58 CDD:278486 16/31 (52%)
Ldl_recept_a 66..104 CDD:278486 16/38 (42%)
Ldl_recept_a 107..143 CDD:278486 20/36 (56%)
Ldl_recept_a 147..179 CDD:278486 16/32 (50%)
Ldl_recept_a 195..231 CDD:278486 18/39 (46%)
Ldl_recept_a 235..270 CDD:278486 18/35 (51%)
LDLa 278..308 CDD:294076 12/30 (40%)
FXa_inhibition 318..>346 CDD:291342 14/28 (50%)
EGF_CA 354..388 CDD:214542 19/36 (53%)
LDL-receptor class B 1 397..438 15/41 (37%)
LY 419..457 CDD:214531 10/38 (26%)
LDL-receptor class B 2 439..485 15/46 (33%)
Ldl_recept_b 439..482 CDD:278487 12/43 (28%)
LDL-receptor class B 3 486..528 12/42 (29%)
Ldl_recept_b 487..525 CDD:278487 10/38 (26%)
LDL-receptor class B 4 529..572 20/43 (47%)
Ldl_recept_b 529..569 CDD:278487 18/40 (45%)
LY 553..595 CDD:214531 22/42 (52%)
LDL-receptor class B 5 573..615 20/42 (48%)
LDL-receptor class B 6 616..658 15/44 (34%)
Ldl_recept_b 616..655 CDD:278487 14/41 (34%)
FXa_inhibition 671..711 CDD:291342 20/40 (50%)
Clustered O-linked oligosaccharides 721..768 12/50 (24%)
Required for MYLIP-triggered down-regulation of LDLR. {ECO:0000269|PubMed:19520913} 811..860 15/38 (39%)
NPXY motif. {ECO:0000269|PubMed:22509010} 823..828 4/5 (80%)
LpR2NP_001097928.1 LDLa 193..224 CDD:197566
LDLa 235..267 CDD:197566 16/31 (52%)
LDLa 277..313 CDD:238060 15/36 (42%)
LDLa 356..388 CDD:197566 16/32 (50%)
LDLa 400..432 CDD:197566 16/32 (50%)
LDLa 442..476 CDD:238060 18/34 (53%)
LDLa 484..517 CDD:197566 13/33 (39%)
FXa_inhibition 527..562 CDD:291342 17/35 (49%)
EGF_CA 564..594 CDD:214542 18/30 (60%)
LY 675..715 CDD:214531 14/40 (35%)
LY 717..760 CDD:214531 17/43 (40%)
LY 763..803 CDD:214531 22/40 (55%)
FXa_inhibition 877..918 CDD:291342 21/44 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1215
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 713 1.000 Inparanoid score I631
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D179614at33208
OrthoFinder 1 1.000 FOG0000315
OrthoInspector 1 1.000 T130091
orthoMCL 1 0.900 OOG5_130540
Panther 1 1.100 O PTHR24270
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R7933
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.910

Return to query results.
Submit another query.