DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LDLR and Culd

DIOPT Version :10

Sequence 1:NP_000518.1 Gene:LDLR / 3949 HGNCID:6547 Length:860 Species:Homo sapiens
Sequence 2:NP_729364.1 Gene:Culd / 38946 FlyBaseID:FBgn0035880 Length:965 Species:Drosophila melanogaster


Alignment Length:34 Identity:16/34 - (47%)
Similarity:21/34 - (61%) Gaps:1/34 - (2%)


- Green bases have known domain annotations that are detailed below.


Human    30 NEFQCQDGKCISYKWVCDGSAECQDGSDESQETC 63
            :||.|.:..|||.:..|||...|.||||| .::|
  Fly   442 SEFLCGNNHCISIRLHCDGFDHCGDGSDE-PDSC 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LDLRNP_000518.1 Ldl_recept_a 25..58 CDD:395011 13/27 (48%)
Ldl_recept_a 66..104 CDD:395011
Ldl_recept_a 107..143 CDD:395011
Binding to Getah virus E1-E2 spike glycoproteins. /evidence=ECO:0000269|PubMed:38245515 146..233
Ldl_recept_a 147..179 CDD:395011
Ldl_recept_a 195..231 CDD:395011
Ldl_recept_a 235..270 CDD:395011
Ldl_recept_a 278..308 CDD:395011
FXa_inhibition 318..>346 CDD:464251
EGF_CA 354..388 CDD:214542
LDL-receptor class B 1 397..438
LY 419..457 CDD:214531
LDL-receptor class B 2 439..485
Ldl_recept_b 439..483 CDD:459654
LDL-receptor class B 3 486..528
Ldl_recept_b 487..526 CDD:459654
LDL-receptor class B 4 529..572
Ldl_recept_b 529..569 CDD:459654
LY 553..595 CDD:214531
LDL-receptor class B 5 573..615
LDL-receptor class B 6 616..658
Ldl_recept_b 616..656 CDD:459654
FXa_inhibition 671..711 CDD:464251
Clustered O-linked oligosaccharides 721..768
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 734..755
Required for MYLIP-triggered down-regulation of LDLR. /evidence=ECO:0000269|PubMed:19520913 811..860
NPXY motif. /evidence=ECO:0000269|PubMed:22509010 823..828
CuldNP_729364.1 CUB 200..298 CDD:238001
LDLa 442..472 CDD:238060 15/30 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.