powered by:
Protein Alignment: LDLR and Culd
Sequence 1: | NP_000518.1 |
Gene: | LDLR |
HGNCID: | 6547 |
Length: | 860 |
Species: | Homo sapiens |
Sequence 2: | NP_729364.1 |
Gene: | Culd |
FlyBaseID: | FBgn0035880 |
Length: | 965 |
Species: | Drosophila melanogaster |
Alignment Length: | 34 |
Identity: | 16/35 (46%) |
Similarity: | 21/35 (60%) |
Gaps: | 1/35 (3%) |
Human 30 NEFQCQDGKCISYKWVCDGSAECQDGSDESQETC 63
:||.|.:..|||.:..|||...|.||||| .::|
Fly 442 SEFLCGNNHCISIRLHCDGFDHCGDGSDE-PDSC 474
|
Known Domains:
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
|
|
|
E1_KOG1215 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.