DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LDLR and LRP1

Sequence 1:NP_000518.1 Gene:LDLR HGNCID:6547 Length:860 Species:Homo sapiens
Sequence 2:NP_001260800.2 Gene:LRP1 FlyBaseID:FBgn0053087 Length:4752 Species:Drosophila melanogaster

Alignment Length:768 Identity:257/769 (33%)
Similarity:372/769 (48%) Gaps:117/769 (15%)


Human    32 FQCQDGKCISYKWVCDGSAECQDGSDESQETCLSVTCKSGDFS---CGGRVNRCIPQFWRCDGQV 93
            |:|..|:||..|::||...:|:|.|||  :.|..:.|:..|.:   ||.. ..||...|||||..
  Fly  2730 FRCGSGECIPRKFLCDSLKDCRDFSDE--KMC
APIPCEKNDMTFVHCGNS-TICIMPRWRCDGDP 2791

Human    94 DCDNGSDEQGCPPKT---CSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQC 155
            ||.:|:||..|...|   |...:|||..|.||:..:.||.::||.|||||.:|.. .|....|.|
  Fly  2792 DCPDGTDELDC
ANHTSLSCDPGQFRCASGNCIAGSWHCDGEKDCPDGSDEINCRT-ECRHNQFAC 2855

Human   156 NSSTCIPQLWACDNDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFHC-LSGECIHSSWRCDGG 219
            : .||||..|.||...||||||||.|| |        .:.||....|.| .||.||...|.|||.
  Fly  2856 D-KTCIPASWQCDGKSDCEDGSDE
GPQ-C--------PNRPCRPHLFQCKSSGRCIPQKWVCDGE 2910

Human   220 PDCK----DKSDEE---NCA----VATCRP---------------------------DEF----- 241
            .||.    |:..|:   .|.    :..|.|                           ||:     
  Fly  2911 KDCPSG
LGDEGSEDEGPQCGGVAHIPDCPPPAHLCTSGLCIDSHYVCDGDEDCPGGDDEYEGCVP 2975

Human   242 --------------QCSDGNCIHGSRQCDREYDCKDMSDEVG--CVNVTLCEGPNKFKCHSGECI 290
                          ||.||.||..::.||.:.||.|.|||..  |.:...|.|.:.|:|.:|.||
  Fly  2976 AFQPHSCPGGSLMHQCQDGLCIFKNQTCDGKPDCGDGSDETSSLCAHTRGCNGTDDFRCKNGACI 3040

Human   291 TLDKVCNMARDCRDWSDEPIKECGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLV--AQRRCE 353
            ..|.:|:...||.|:|||.:  |..||||..: .|.|.|.|..:||:|.|..|::::  :...|.
  Fly  3041 HADLLCDRRNDCADFSDEEL--CNVNECLIPD-ICEHECEDKVVGYQCHCRPGYKVLPKSPHLCT 3102

Human   354 DIDECQDPDTCSQLCVNLEGGYKCQCEEGFQL-DPHTKACKAVGSIAY-LFFTNRHEVRKMTLDR 416
            |||||.:...|||.|:|..|.|||.|.:|:.| |.||  |||..:::. |.|:||:.:|::.: .
  Fly  3103 DIDECDEQQPCSQTCINTYGSYKCLCAKGYALVDHHT--CKATSNVSMELIFSNRYYIRQVDM-T 3164

Human   417 SEYTSLIPNLRNVVALDTEVASNRIYWSDLSQ-----RMICSTQLDRAHGVSSYDTVISRDIQAP 476
            ...:.||..|.|.||||.:..|..:||||::.     :..|..:       :...|:....::.|
  Fly  3165 GNGSILINELSNAVALDYDWDSQCLYWSDVTSTVGTIKRYCPKE-------NKTQTLHQAMLKNP 3222

Human   477 DGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRAIVVDPVHGFMYWTDWGTPAK 541
            |||||||:..|:||.|..|.|:.|:...|..||.|..|...:||.|.:.|....::|:|||....
  Fly  3223 DGLAVDWVAKNLYWCDKGLDTIEVSQLDGKYRKVLINEYLREPRGIALHPYQQHIFWSDWGDSPH 3287

Human   542 IKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRKTILEDE---- 602
            |.|.|::|.:...::.:.:.|||.:|:...:.:|:|.|::..:||..|::|.:.:.:|...    
  Fly  3288 IGKAGMDGSNPKMIIRDGLGWPNALTISFETQQLFWGDAREDTISVSDLDGNHTRLLLARSINPL 3352

Human   603 KRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSPEDMVLFH--NLTQPRGVN 665
            ..|.|.|::||:|..::|:|...::|...:...|.:...|...:..|.|:.:||  ...||...|
  Fly  3353 LNLHHIFAIAVWEGHIYWSDWETKSIEYCSIFNGQNCTTLITTIHRPMDLRVFHPYRQQQPMSGN 3417

Human   666 WCERTTLSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLARDMRSCLTEAEAA 718
            .|     ....|..||:    ::|..|.:.|.||...:||.|.|:|.....||
  Fly  3418 PC-----LAANCSTLCV----LSPEEPYYKCMCPTNFILADDGRTCRANCTAA 3461

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LDLRNP_000518.1 Ldl_recept_a 25..58 CDD:278486 12/26 (46%)
Ldl_recept_a 66..104 CDD:278486 16/41 (39%)
Ldl_recept_a 107..143 CDD:278486 17/39 (44%)
Ldl_recept_a 147..179 CDD:278486 17/32 (53%)
Ldl_recept_a 195..231 CDD:278486 16/44 (36%)
Ldl_recept_a 235..270 CDD:278486 18/83 (22%)
LDLa 278..308 CDD:294076 13/30 (43%)
FXa_inhibition 318..>346 CDD:291342 11/28 (39%)
EGF_CA 354..388 CDD:214542 18/35 (51%)
LDL-receptor class B 1 397..438 13/42 (31%)
LY 419..457 CDD:214531 14/43 (33%)
LDL-receptor class B 2 439..485 14/51 (27%)
Ldl_recept_b 439..482 CDD:278487 12/48 (25%)
LDL-receptor class B 3 486..528 16/42 (38%)
Ldl_recept_b 487..525 CDD:278487 15/38 (39%)
LDL-receptor class B 4 529..572 12/43 (28%)
Ldl_recept_b 529..569 CDD:278487 12/40 (30%)
LY 553..595 CDD:214531 11/42 (26%)
LDL-receptor class B 5 573..615 13/46 (28%)
LDL-receptor class B 6 616..658 9/44 (20%)
Ldl_recept_b 616..655 CDD:278487 7/39 (18%)
FXa_inhibition 671..711 CDD:291342 12/40 (30%)
Clustered O-linked oligosaccharides 721..768
Required for MYLIP-triggered down-regulation of LDLR. {ECO:0000269|PubMed:19520913} 811..860
NPXY motif. {ECO:0000269|PubMed:22509010} 823..828
LRP1NP_001260800.2 LDLa 87..118 CDD:197566
LDLa 126..163 CDD:238060
EGF_CA 246..283 CDD:214542
Ldl_recept_b 449..487 CDD:278487
LY 472..513 CDD:214531
LY 817..852 CDD:214531
LDLa 1057..1092 CDD:197566
LDLa 1104..1134 CDD:238060
FXa_inhibition 1289..1317 CDD:291342
LY 1434..1476 CDD:214531
LY 1477..1521 CDD:214531
LY 1533..1567 CDD:214531
LY 1568..1611 CDD:214531
FXa_inhibition 1639..1676 CDD:291342
LY 1794..1838 CDD:214531
LY 2078..2112 CDD:214531
NHL <2082..>2152 CDD:302697
NHL repeat 2082..2120 CDD:271320
FXa_inhibition 2269..2303 CDD:291342
LY 2430..2471 CDD:214531
LY 2475..2517 CDD:214531
LDLa 2630..2661 CDD:238060
LDLa 2671..2702 CDD:238060
LDLa 2727..2759 CDD:238060 13/31 (42%)
LDLa 2773..2802 CDD:238060 14/30 (47%)
LDLa 2810..2844 CDD:238060 16/34 (47%)
LDLa 2848..2878 CDD:238060 17/31 (55%)
LDLa 2887..2916 CDD:197566 13/29 (45%)
LDLa 2938..2969 CDD:197566 3/31 (10%)
LDLa 2989..3015 CDD:197566 13/26 (50%)
LDLa 3030..3061 CDD:238060 13/33 (39%)
EGF_CA 3062..>3091 CDD:214542 13/30 (43%)
EGF_CA 3103..3141 CDD:214542 21/40 (53%)
LY 3212..3254 CDD:214531 17/42 (40%)
LY 3255..3297 CDD:214531 15/42 (36%)
LY 3299..3340 CDD:214531 11/41 (27%)
LY 3354..3389 CDD:214531 10/35 (29%)
LDLa 3458..3490 CDD:238060 2/5 (40%)
LDLa 3499..3533 CDD:238060
LDLa 3582..3616 CDD:238060
LDLa 3621..3652 CDD:197566
LDLa 3663..3697 CDD:238060
LDLa 3702..3736 CDD:238060
LDLa 3776..3808 CDD:197566
LDLa 3818..3849 CDD:197566
LDLa 3860..3894 CDD:238060
NHL 4029..>4158 CDD:302697
NHL repeat 4034..4074 CDD:271320
NHL repeat 4076..4115 CDD:271320
LY 4108..4150 CDD:214531
NHL repeat 4121..4158 CDD:271320
EGF_CA <4386..4414 CDD:238011
EGF_CA 4415..4450 CDD:238011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.