DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LDLR and Lrp4

Sequence 1:NP_000518.1 Gene:LDLR HGNCID:6547 Length:860 Species:Homo sapiens
Sequence 2:NP_727914.1 Gene:Lrp4 FlyBaseID:FBgn0030706 Length:2009 Species:Drosophila melanogaster

Alignment Length:955 Identity:283/956 (30%)
Similarity:424/956 (44%) Gaps:207/956 (22%)


Human    50 AECQDGSDESQETC---------LSVTC-KSGDFSCGGRVNRCIPQFWRCDGQVDCDNGSDEQGC 104
            :.||: |:||.|.|         |...| |:|......|..|||.::|.|||..||.:.|||..|
  Fly   198 SNCQN-SNESDENCNPEEDAVPNLQRDCEKTGIHVMCPRTFRCISKYWLCDGDDDCGDYSDETHC 261

Human   105 PPKT-CSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACD 168
            ..:| |:.|:|.|.:|.||.|.:|||.:.||.|.|||..|...||....|.||...||...:.||
  Fly   262 GARTNCTDDQFECLNGFCIPRTWVCDGENDCKDFSDETHCNRTTCTDEHFTCNDGYCISLAFRCD 326

Human   169 NDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCL---------SGECIHSSWRCDGGPDCKD 224
            .:.||.|.|||  .:|..:.      :.|...||.|.         ||:||.:.:||||..||.|
  Fly   327 GEHDCNDNSDE--LKCAAVI------NSCPEGEFKCRGGLGGAGGPSGQCILNRFRCDGDNDCGD 383

Human   225 KSDEENC--AVATCRPDEFQCSDGNCIHGSRQCDREYDCKDMSDEVGCVNV----TLCEGPNKFK 283
            .||||||  ..:.|..:|::|:||.||....:||:|.||....||..|.::    .|..|.::|.
  Fly   384 WSDEENCPQKPSLCTSNEYKCADGTCIPKRWKCDKEQDCDGGEDENDCGSLGSEHPLTCGSDEFT 448

Human   284 CHSGECITLDKVCNMARDCRDWSDE--------------PIKE--------------C-GTNEC- 318
            |::|.||....:|:...||....||              |.|:              | |.||| 
  Fly   449 CNNGRCILKTWLCDGYPDCAAGEDEVECHLQCDLGQFLCPTKQNLTNLKICVHQKHICDGHNECP 513

Human   319 -------------LDNNGGCSHVCNDLKIG-YECLCPDGFQLVAQR-RCEDIDECQ--DPDTCSQ 366
                         ......|..:|.:...| .||.|..|:.:...: .|.||||||  ....|||
  Fly   514 AGEDEADCPKERKCSEPSPCEQLCIETTAGSNECACRLGYVMDKNKVNCTDIDECQYLTSPVCSQ 578

Human   367 LCVNLEGGYKCQCEEGFQLDPHTKACKAVGSIAYLFFTNRHEVRKMTLDRSEYTSLIPNLRNVVA 431
            .|.|..|.:||.||.|:.|.|..::|||:|....|...||.::|::||..:.|::::..|.|.:|
  Fly   579 KCHNTMGSFKCSCETGYILRPDLRSCKALGGAMTLLVANRWDIRRVTLSNNRYSAIVKGLHNAIA 643

Human   432 LDTEVASNRIYWSDLSQRMICSTQLDRAHGVSSYDTVISRDIQAPDGLAVDWIHSNIYWTDSVLG 496
            ||.......::|||:|..:|   ::...:|....| ||...:::|.|:||||||..::||||...
  Fly   644 LDFHHRKGLMFWSDVSTDVI---KMVYMNGTRVRD-VIKWGLESPGGIAVDWIHDLLFWTDSGTR 704

Human   497 TVSVADTKGVKRKTLFRENGSKPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIYSLVTENIQ 561
            .|.|::.:|..|..:...:..|||||||.|.....:|:|||...||::..::|.....::::.:.
  Fly   705 RVEVSNFQGNLRTVIASYDLDKPRAIVVHPGEALAFWSDWGPNPKIERAYMDGTQRKVIISKGVT 769

Human   562 WPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINE 626
            ||||:.:|..:.::||.|:|.|:|...:::|.:|..||  ...|.|||:|.:|||.::|||...:
  Fly   770 WPNGLAIDFPNSKIYWADAKQHAIECSNLDGSDRNKIL--STHLPHPFALTLFEDTMYWTDWNTK 832

Human   627 AIFSANRLTGSDVNLLAENLLSPEDMVLFHNLTQPRGVNWCERTTLS-NGGCQYLCLPAPQINPH 690
            .:.:|:::||.:...:.||...|.|:..:|...||...:.|::.... .|||.:||||    |..
  Fly   833 TVSAADKITGKEFRAVHENFHFPMDIHAYHPARQPEYADRCQKDRRGLRGGCSHLCLP----NKT 893

Human   691 SPKFTCACPDGMLLARDMRSCLTEAEAAVATQETSTVRLK------------------------- 730
            |.:  |.||.|:.|..|.::|.:.|:..|.......:||:                         
  Fly   894 SRR--CGCPIGLSLKEDGKTCKSTADKLVLVARRKDIRLRHLRDNQADPNDVDMIVPLDNLKHAV 956

Human   731 ---------------VSSTAVRTQH------------TTTRPVP-----DTSRLPGATPGLTTVE 763
                           |..:.:...|            ....||.     .|.:|....|....:|
  Fly   957 ALDWCSDTDFIYWTDVERSTINKAHLNGSYQQRVVHSNLVSPVGLALDWITDKLYWTDPSTNRIE 1021

Human   764 IVTMSHQALGDVAGRGN-----EK--KPSSVRALSIVLPIVLLVFLCLGVFLLWKNWRLKNINSI 821
            :.|.:        |:..     ||  ||..:    :|.||        ..|:.|.:|.       
  Fly  1022 VATTN--------GKMRTLLIWEKLYKPRDI----VVNPI--------EGFMFWSDWG------- 1059

Human   822 NFDNPVYQKTTEDEVHICHNQDGYS----------YPSRQMVSLE 856
              |:|:.::.         |.||:.          ||:...:..|
  Fly  1060 --DDPMIERA---------NMDGHERVTITSKKLIYPNGLAIDYE 1093

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LDLRNP_000518.1 Ldl_recept_a 25..58 CDD:278486 3/8 (38%)
Ldl_recept_a 66..104 CDD:278486 16/39 (41%)
Ldl_recept_a 107..143 CDD:278486 18/37 (49%)
Ldl_recept_a 147..179 CDD:278486 14/32 (44%)
Ldl_recept_a 195..231 CDD:278486 20/45 (44%)
Ldl_recept_a 235..270 CDD:278486 14/35 (40%)
LDLa 278..308 CDD:294076 10/30 (33%)
FXa_inhibition 318..>346 CDD:291342 8/43 (19%)
EGF_CA 354..388 CDD:214542 19/36 (53%)
LDL-receptor class B 1 397..438 12/41 (29%)
LY 419..457 CDD:214531 11/38 (29%)
LDL-receptor class B 2 439..485 16/46 (35%)
Ldl_recept_b 439..482 CDD:278487 13/43 (30%)
LDL-receptor class B 3 486..528 16/42 (38%)
Ldl_recept_b 487..525 CDD:278487 15/38 (39%)
LDL-receptor class B 4 529..572 12/43 (28%)
Ldl_recept_b 529..569 CDD:278487 11/40 (28%)
LY 553..595 CDD:214531 12/42 (29%)
LDL-receptor class B 5 573..615 16/42 (38%)
LDL-receptor class B 6 616..658 12/42 (29%)
Ldl_recept_b 616..655 CDD:278487 11/39 (28%)
FXa_inhibition 671..711 CDD:291342 15/41 (37%)
Clustered O-linked oligosaccharides 721..768 11/104 (11%)
Required for MYLIP-triggered down-regulation of LDLR. {ECO:0000269|PubMed:19520913} 811..860 9/57 (16%)
NPXY motif. {ECO:0000269|PubMed:22509010} 823..828 2/5 (40%)
Lrp4NP_727914.1 LDLa 267..301 CDD:238060 17/34 (50%)
LDLa 306..340 CDD:238060 14/36 (39%)
LDLa 347..390 CDD:238060 20/43 (47%)
LDLa 397..431 CDD:238060 14/34 (41%)
LDLa 442..476 CDD:238060 11/34 (32%)
LDLa 480..521 CDD:238060 7/41 (17%)
FXa_inhibition 576..604 CDD:291342 13/28 (46%)
LY 634..671 CDD:214531 11/40 (28%)
NHL <656..793 CDD:302697 49/141 (35%)
LY 680..714 CDD:214531 15/34 (44%)
NHL repeat 681..722 CDD:271320 16/41 (39%)
NHL repeat 726..760 CDD:271320 15/34 (44%)
LY 761..803 CDD:214531 12/42 (29%)
NHL repeat 769..793 CDD:271320 10/24 (42%)
FXa_inhibition 882..912 CDD:291342 15/36 (42%)
LY 946..985 CDD:214531 2/39 (5%)
NHL <967..1142 CDD:302697 28/166 (17%)
LY 988..1030 CDD:214531 8/50 (16%)
NHL repeat 998..1037 CDD:271320 9/47 (19%)
NHL repeat 1038..1080 CDD:271320 13/72 (18%)
NHL repeat 1084..1119 CDD:271320 3/11 (27%)
FXa_inhibition 1185..1220 CDD:291342
NHL 1260..>1445 CDD:302697
NHL repeat 1260..1296 CDD:271320
NHL repeat 1302..1337 CDD:271320
NHL repeat 1345..1383 CDD:271320
FXa_inhibition <1499..1525 CDD:291342
LY 1600..1640 CDD:214531
LY 1643..1686 CDD:214531
LY 1688..1729 CDD:214531
FXa_inhibition 1801..>1825 CDD:291342
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.